KEGG   Rattus norvegicus (rat): 25484
Entry
25484             CDS       T01003                                 

Gene name
Myo1e, MYR5, Myr3
Definition
(RefSeq) myosin IE
  KO
K10356  myosin I
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25484 (Myo1e)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25484 (Myo1e)
   03036 Chromosome and associated proteins [BR:rno03036]
    25484 (Myo1e)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25484 (Myo1e)
   04147 Exosome [BR:rno04147]
    25484 (Myo1e)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25484 (Myo1e)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Others
    25484 (Myo1e)
 Others
  Actin-binding proteins
   Myosins
    25484 (Myo1e)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    25484 (Myo1e)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25484 (Myo1e)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25484 (Myo1e)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 SH3_1 SH3_9 SH3_2 AAA_16 IQ AAA_22 Sigma54_activat
Other DBs
NCBI-GeneID: 25484
NCBI-ProteinID: NP_775124
RGD: 3144
Ensembl: ENSRNOG00000061928
UniProt: Q63356
Position
8q24
AA seq 1107 aa
MGSKGAYRYHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVN
PFKQMPYFGEKEIEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTV
AAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSP
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASPEQKQSLGITSMDYYYYLSL
SGSYKVDDIDDKRDFQETLHAMNVIGIFSEEQTLVLQIVAGILHLGNINFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALH
ARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIESKVNPPGIMSILDDVCATMHAVGEGADQT
LLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELP
FIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPKDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPVWRGDEKQGVLHLLQ
SVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKTWRKFVARKKYVQMRE
DASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADIVTKYDRRFKGV
KRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEVERILSVSLSTMQDDIFILHEQE
YDSLLESVFKTEFLSLLTKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFY
QGFGDLAILKPSNKVLQVSIGPGLPKNARPTRRNTVSSRGYSGGTNNNYPMRAAPAPPGC
HRNGLTRNQFVHPPRASGNQRSNQKSLYTSMARPPLPRQQSTGSDRLSQTPESLDFLKVP
DQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDVIDII
KEDPSGWWTGRLRGKQGLFPNNYVTKI
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgggcagcaaaggcgcctaccggtaccattggcagagccacaatgtcaagcacagtggt
gtggacgacatggtactactctccaagatcacagagagctccatcgtagagaacctgaag
aagagatacatggacgactatatttttacatatatagggtctgtcttaatctctgtcaac
cctttcaagcaaatgccatattttggagaaaaagagattgaaatgtaccaaggagcggcc
cagtatgagaacccacctcatatctatgcccttgcagacagtatgtacagaaacatgatc
atcgacagagagaaccagtgtgtcatcatcagtggtgaaagtggtgctggaaagacagta
gctgccaagtacatcatgagctacgtctccagagtgtccggaggaggccccaaggtccag
catgtcaaggacatcatccttcagtccaacccactcctggaggccttcgggaatgccaag
acagtccgcaacaacaactccagccgatttggaaaatactttgaaatccagttcagtcca
ggtggggaaccagatggtggcaagatctccaacttccttctggaaaagtccagagtggtg
atgaggaacccgggagaacggagcttccacatattctaccagctcatcgagggcgcctct
ccagagcagaagcaaagccttggtatcaccagcatggactactattattacctgagcctc
tcagggtcatacaaggttgatgacattgatgacaagcgggatttccaggaaaccctgcac
gccatgaatgtgattgggatcttctcagaggagcagactctcgtgctgcagattgtggct
ggaattctccacttgggaaacatcaacttcaaggaagtgggcaactatgcggccgtggag
agcgaagaatttttggcttttcctgcgtatctgctgggtataaaccaagaccggttaaaa
gagaagctgacgagccggcagatggacagtaagtggggaggaaagtcagagtccatccat
gtgaccctcaatgtggagcaggcctgctacaccagggatgccctcgccaaggccctgcac
gcgcgagtctttgatttcttggtggattccatcaataaagctatggagaaggaccacgag
gagtacaacattggtgtcctggacatctatggctttgaaatatttcagaaaaatggcttc
gagcagttctgcatcaatttcgttaatgaaaaattacagcagatttttatcgagctgacg
ctaaaggccgagcaggaagaatacgttcaggaggggataagatggacacccattgaatat
ttcaataataaaattgtgtgtgacctcatagagagcaaagtcaaccctcctggaattatg
agcatcctggatgacgtgtgtgccaccatgcatgctgtgggtgagggtgctgaccagaca
ctgctacagaagctccagatgcagatcgggagccatgagcactttaacagctggaaccaa
ggtttcattattcaccactatgctgggaaggtttcctatgacatggatggcttctgtgaa
aggaaccgggatgtgctattcatggacctgattgagctcatgcagagcagtgagctgcct
tttataaagtctttatttcctgaaaacctgcaagccgacaagaaagggcgcccaacgact
gcaggaagcaaaataaagaaacaagccaatgacctcgtgagcaccctgatgaaatgtaca
ccccactacattcgctgcataaaaccgaacgaaaccaagaagcccaaagactgggaggag
agcagagtgaagcatcaagtggagtacctgggtctcaaggaaaacatccgagtgagaagg
gctggttatgcttatcggcgtgtcttccagaaatttctacagaggtatgccattctgacc
aaagctacctggcctgtgtggagaggagatgagaaacaaggtgtcctccatctgctacag
tctgtcaacatggacagcgaccagttccagctcgggaggagtaaagtgttcatcaaagcc
ccggagtctctatttcttctggaagagatgagagagagaaagtatgatgggtacgcacgc
gtgatacagaaaacatggaggaagtttgtggcccgcaagaagtatgtccagatgagagaa
gacgcctcagacctgttgttgaacaagaaggagaggaggagaaacagcatcaaccgaaac
ttcatcggggactacatcgggatggaggagcacccggagctccagcagtttgtgggcaag
agggagaagattgactttgctgacatagtcaccaagtatgacaggaggttcaagggtgtc
aagcgagacctgctgctaaccccaaagtgcttgtacttaattggaagggagaaggtgaag
caaggcccggacaaaggtcttgtgaaggaagtcctgaagcggaagatcgaggtggaaagg
atcctgtccgtgtccctcagtaccatgcaggatgacatcttcattctccatgagcaagag
tatgacagtttgcttgagtccgtctttaaaacagagttcctgagccttttaacaaagcga
tatgaggaaaaaacccagaagcaactacctctgaaattcagcaatacccttgaactgaag
ttgaaaaaggagaactggggtccctggagtgctgggggctcccggcaagtgcagttctac
caaggcttcggtgacctggccatcctcaagcccagcaacaaagtgctgcaggtcagcatt
ggacctgggctgcccaagaacgcccgtcccaccagaagaaacactgtctcaagcagaggg
tattctggtggaactaacaacaattacccgatgagagccgcccctgctcccccaggatgc
catcgaaatggcctcaccagaaaccagtttgtgcatcctccccgtgcctctggaaaccag
aggtccaatcagaaaagcctatacacctctatggcccgcccacccttgccaaggcaacag
tccacaggctcagaccgattgtctcagacaccggagagcctggatttcctcaaggtcccg
gaccagggtgctgctggagtccgaagacaaacgaccagccggcctcccccagcaggcggc
agaccaaagcctcagcccaagcctaagcctcaggtgccgcagtgcaaggctctgtatgcc
tacgatgctcaggacacagacgaactcagcttcaatgccaatgacgtcatcgatattatt
aaggaagatccttctggctggtggacgggtagactacgaggcaagcagggcctgtttcct
aacaactatgtcaccaagatctga

DBGET integrated database retrieval system