KEGG   Rattus norvegicus (rat): 25496
Entry
25496             CDS       T01003                                 

Gene name
Notch1
Definition
(RefSeq) neurogenic locus notch homolog protein 1 precursor
  KO
K02599  Notch 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05020  Prion disease
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    25496 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    25496 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25496 (Notch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25496 (Notch1)
   05206 MicroRNAs in cancer
    25496 (Notch1)
  09162 Cancer: specific types
   05224 Breast cancer
    25496 (Notch1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25496 (Notch1)
  09164 Neurodegenerative disease
   05020 Prion disease
    25496 (Notch1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25496 (Notch1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch NOD Ank_2 Ank NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Other DBs
NCBI-GeneID: 25496
NCBI-ProteinID: NP_001099191
RGD: 3187
Ensembl: ENSRNOG00000019322
UniProt: Q07008
Structure
PDB: 
4XL1 5UK5 4XLW

Position
3
AA seq 2531 aa
MPRLLAPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDP
SPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGLCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQ
YHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCRNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQEDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GREEELRKHPIKRSAVGWATTSLLPGTNGGRQRRELDPMDIHGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSETVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACSS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHGMMGPI
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQIQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMP
SQITHIPEAFK
NT seq 7596 nt   +upstreamnt  +downstreamnt
atgccgcggctcctggcgcccttgctctgcctaacgctgctgcccgcgctcgccgcaaga
ggcttgagatgctcccagccaagtgggacctgcctgaatggagggaggtgcgaagtggcc
aacggcactgaagcctgtgtctgcagcggagcgttcgtgggccagcgatgccaggacccc
agcccttgcctcagcacaccatgtaagaatgctggaacgtgctatgttgtggaccatggc
ggcatcgtggactatgcctgcagttgccccctgggtttctctgggcccctctgcctgaca
cctctggccaatgcctgcctggccaacccctgccgcaacggggggacctgtgacctgctc
actctcacagaatacaagtgccggtgcccgccagggtggtcaggaaagtcatgtcagcaa
gccgacccctgtgcctccaacccctgtgccaatggtggccagtgcctgccctttgagtct
tcatacatctgtggctgcccgcccggcttccatggccccacctgcagacaagatgttaac
gagtgcagccagaaccctgggttgtgccgtcatggcggcacgtgccacaatgagattggc
tcctatcgctgtgcctgccgtgccacccacactggtccccactgcgagctgccctacgtg
ccctgcagcccctcaccctgccagaacggaggcacctgccgccctacgggggacaccacc
cacgagtgtgcctgcctgccaggctttgctggacagaactgtgaagaaaatgtggatgac
tgcccaggaaacaactgcaagaacgggggtgcctgtgtggacggtgtgaatacctacaat
tgccgctgcccaccggagtggacaggtcagtactgcacagaggatgtggacgagtgtcag
ctcatgcccaacgcctgccagaatggcggaacctgccacaactcccacggtggctacaac
tgcgtgtgtgtcaatggctggactggtgaggactgcagtgagaacattgatgactgtgcc
agtgccgcctgttttcagggtgccacctgccatgaccgtgtggcttccttctactgcgag
tgtccacatgggcgcacaggcctgctgtgccacctgaacgatgcgtgtatcagcaacccc
tgcaacgagggctccaactgcgacaccaaccctgtcaacggcaaggccatctgcacttgc
ccctcggggtacacggggccagcctgcagccaggacgtggatgagtgcgctctaggtgcc
aacccgtgtgagcacgcgggcaagtgcctcaacacactgggctctttcgagtgtcagtgt
ctacagggctacactgggccccgctgtgagattgatgtcaacgagtgcatctccaaccca
tgtcagaatgatgccacgtgcctggaccagattggggagtttcagtgtatatgtatgcca
ggttatgagggtgtatactgtgagatcaacacggacgagtgtgccagcagcccctgtcta
cacaatggccgctgcgtggacaagatcaacgagttcctgtgtcagtgtcccaaaggcttc
agcgggcacctgtgccagtatgacgtggatgagtgcgccagcacaccatgcaagaacggc
gccaagtgcctggatgggcccaacacctacacctgcgtgtgcacagaaggttacacgggg
acccactgcgaggtggacattgacgagtgtgaccctgacccctgtcactatggtttgtgc
aaggatggtgtggccacctttacctgcctctgccagccaggctacacaggccatcactgt
gagaccaacattaatgagtgtcacagccagccgtgccgccatggcggcacctgccaggac
cgtgacaactactacctctgcttatgcctcaaggggaccacaggacccaactgtgagatc
aatctggatgactgtgcgagcaacccctgtgactctggcacgtgtctggacaagatcgat
ggctacgagtgtgcgtgcgagccaggctacacagggagcatgtgtaatgtcaacattgac
gaatgtgcgggcagcccctgccacaacgggggcacctgtgaggatggcatcgccggcttc
acttgccgctgccccgagggctaccacgaccctacgtgcctgtctgaggtcaacgagtgc
aacagtaacccctgcatccatggagcttgccgggatggcctcaatggatacaaatgtgac
tgtgcccctgggtggagtgggacaaactgtgacatcaacaacaatgagtgtgagtccaac
ccttgtgtcaacggtggcacctgcaaagacatgaccagtggctacgtatgcacctgccga
gaaggcttcagtggccctaactgccagaccaacattaacgaatgtgcttccaacccctgc
ctgaaccagggcacctgcattgatgatgtcgctgggtacaaatgcaactgccctctgccc
tatacaggagccacatgtgaggtggtgttggccccatgtgccaccagcccctgcaaaaac
agtggggtatgcaaggagtctgaggactatgagagcttttcctgtgtctgtcccacaggc
tggcaaggtcaaacctgcgagatcgacatcaatgagtgtgtgaaaagcccgtgtcgccat
ggtgcctcttgccagaacaccaatggcagctaccgctgcctctgccaggctggctacacg
ggtcgcaactgcgagagtgacatcgatgactgccgacccaacccatgtcacaacgggggt
tcctgcactgacggggtcaacgcggccttctgcgactgcctgcccggcttccagggtgcc
ttctgtgaggaggacatcaacgaatgcgccagcaatccatgccaaaatggcgccaactgc
actgactgcgtggacagctacacgtgcacctgccccacgggcttcaatggcatccattgc
gagaacaacacacctgactgtaccgagagctcctgtttcaatggtggcacctgtgtggat
ggtatcaactccttcacctgtctgtgcccacctggcttcacgggcagctactgccagtat
gacgtcaatgagtgtgactcacggccctgtctgcatggtggcacctgccaagacagctat
ggtacctataagtgtacctgcccacagggctacactggtctcaactgccagaaccttgtg
cgctggtgtgactcagctccctgcaagaatggcggcaagtgctggcagaccaacacacag
taccactgcgagtgccgcagcggctggactggcttcaactgcgacgtgctcagtgtgtcc
tgcgaggtggctgcacagaagcgaggcatcgatgtcactctcctatgccagcacggaggg
ctctgtgtggatgaggaagacaagcattactgccactgccaggcaggatacacgggcagc
tactgtgaggacgaggtggacgagtgctcacctaatccctgccagaacggagccacctgc
actgactatctcggtggcttttcctgcaagtgtgtggctgggtaccatggctctaactgc
tctgaggagatcaacgagtgcctatcccaaccctgccagaatgggggtacctgcattgat
ctgaccaacacctacaagtgctcctgccccaggggcacacagggtgtacactgtgagatc
aacgtcgatgactgccatcctcccctagaccctgcttcccgaagccccaaatgcttcaat
aatggcacctgcgtggaccaggtgggtggctatacctgcacctgcccgccaggcttcgtc
ggggagcggtgcgagggcgatgtcaatgagtgtctctccaacccctgtgacccacgtggc
acccagaactgcgtgcagcgtgttaatgacttccactgcgagtgccgggctggccacact
ggacgccgctgtgagtcggtcattaatggctgcaggggcaaaccatgcaggaatggaggt
gtctgtgctgtggcctccaacaccgcccgtggattcatctgtaggtgccctgcgggcttc
gagggtgccacttgtgaaaatgacgcccgcacttgtggcagtttgcgctgcctcaacggt
ggtacgtgcatctcaggcccacgcagtcccacctgcctatgcctgggctccttcactggc
cctgaatgccagttcccagccagcagcccctgtgtgggtagcaacccctgctacaatcag
ggcacctgtgagcccacatccgagagccctttctaccgctgtctatgccctgccaaattc
aacgggctgctgtgccacatcctggactacagcttcacaggtggcgccgggcgcgacatt
cccccgccacagattgaggaggcctgcgaactgcctgagtgccaggaggatgcaggcaat
aaggtctgcaaccttcagtgtaataatcacgcgtgtggctgggacggcggcgactgctcc
ctcaacttcaatgacccttggaagaactgcactcagtccctgcagtgctggaagtatttt
agtgacggccactgtgacagccagtgcaactcagctggctgcctttttgatggcttcgac
tgccagctcaccgagggacagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agtgatggccactgcgaccagggctgcaacagtgccgagtgtgagtgggatggactggac
tgtgcagagcatgtccccgagcgactggcagccggcacactggtgctggtggtgctgctt
ccgcccgatcagctacgcaacaactccttccacttcctgcgggagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgacgcgcagggccagcagatgatcttcccctactat
ggccgcgaggaagagctacgcaagcacccgatcaagcgttctgcagtgggctgggccaca
acgtcactgcttcctggcaccaatggtgggcgccagcgcagggagctggaccccatggac
atccatggctccatcgtctacctggagatcgacaaccggcagtgtgtacagtcatcctcg
caatgcttccagagcgccaccgatgtggctgccttcctaggtgctcttgcctccctcggc
agcctcaatatcccctacaagatcgaagccgtaaagagtgagacggtggagcctccgctg
ccctcacagctgcacctcatgtacgtggcggcagctgccttcgtgctcctgttctttgtg
ggctgtggggtgctgctgtcccgcaagcgcaggcggcagcatggccagctctggttccct
gagggtttcaaagtgtcagaggccagcaagaagaagcggagagaacccctcggcgaggac
tcagtcggcctcaagcccctgaagaacgcctcagatggtgccctgatggacgacaatcag
aacgagtggggggacgaagacctggagaccaagaagttccggtttgaggaaccagtggtt
ctccctgacctggatgatcagactgaccaccggcagtggacccagcagcacctggatgcc
gctgacctacgtgtgtctgccatggccccaacgccgcctcagggggaggtagatgctgac
tgcatggacgtcaatgttcgaggaccagatggcttcactcccctaatgattgcctcctgc
agcggagggggcctggagacaggcaacagtgaggaagaagaagatgcacctgctgtcatc
tccgacttcatctatcagggtgccagcttgcacaaccagacggaccgcacaggggagact
gccctgcacctggctgcccgatactctcgttcagatgctgccaagcgcttgctggaggcc
agcgcagatgccaacatccaagacaacatggggcgtaccccattacatgccgctgtttct
gcagacgctcagggtgtcttccagatcctgctccggaacagagccacagatctggatgcc
cgaatgcatgatggcacaacccctctgatcctggcggcacgcctggccgtggaaggcatg
ctagaggacctcatcaactctcacgctgatgtcaatgctgtggatgacctaggcaagtca
gctctgcactgggcagccgctgtgaacaatgtggacgctgctgttgtgctcctgaagaac
ggagccaacaaagacatgcagaacaacaaggaggagactcccctgttcctggccgcccgt
gagggcagctatgagactgccaaagtgttgctggaccactttgccaaccgggacatcacg
gatcacatggaccgattgccacgggacattgcacaggagcgcatgcaccacgatatcgtg
cggcttttggatgaatacaacctggtgcgcagcccacagctgcatggcactgccttgggt
ggcacacccactctgtctcccacactctgctcgcccaacggctacctgggcaacctcaag
tctgccacacagggcaagaaggcccgaaagcccagcaccaaagggctggcttgcagtagc
aaggaagctaaggacctcaaggcccggaggaagaagtcccaggatggcaagggctgcctg
ttggacagctcaagcatgctgtcacccgtggactccctcgagtcaccccatggctacttg
tcagatgtggcctcaccacccctccttccctccccgttccagcagtctccatccatgcct
ctcagccacctgccaggtatgcctgacacccacctgggcatcagccacttgaatgtggca
gccaagcccgagatggcagctctggccggaggcagccggttggcctttgagccaccccca
ccacgcctctcccacctgcctgtagcctccagtgccagcacagtgctgagtaccaatggc
acaggggctatgaatttcaccgtgggtgcaccggcaagcttgaatggccagtgtgagtgg
cttccccggctccagaatggcatggtgcccagccagtacaacccgctaaggccaggtgtg
actccgggcacactaagcacacaggcagctggcctccagcatggcatgatgggcccgata
cacagcagcctctccaccaataccttgtccccgattatctaccagggcctgcccaacaca
aggctggccacacagccccacctggtgcagacccagcaggtgcagccacagaacttacaa
atccagcctcagaacctgcagccaccatcgcagccacacctcagtgtgagctcagcagcc
aatgggcacctgggtcggagcttcctgagcggggagcccagccaggcagacgtacagccg
ctgggccccagcagtctgcctgtgcacaccattctgccccaggaaagccaggctctgccg
acatcactgccatcctccatggtcccacccatgaccactacccagttcctgacccctcct
tctcagcacagctactcatcctcacctgtggacaacacccccagccaccagctgcaggtg
ccagagcaccccttcctcaccccatcccctgagtcccctgaccagtggtccagctcctcc
ccgcattccaacatctctgattggtccgagggcatctctagcccgcccacgagcatgccg
tcccagatcacccacattccagaggcatttaagtaa

DBGET integrated database retrieval system