KEGG   Rattus norvegicus (rat): 25600Help
Entry
25600             CDS       T01003                                 

Gene name
Utrn
Definition
(RefSeq) utrophin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH EF-hand_2 EF-hand_3 ZZ WW CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 25600
NCBI-ProteinID: NP_037202
RGD: 3947
Ensembl: ENSRNOG00000011058
UniProt: O55147
Structure
PDB: 

Position
1p13
AA seq 3419 aa AA seqDB search
MAKYGHLEASPDDGQNQFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFSDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNP
KLTLGLLWSIILHWQVKDVMKDIMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDRVVKMSPTERLEHAFSKAHTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEGEEINIQSAVLTEEGQSPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELS
AHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALM
ELQKKQLQQLSGWLTLTEERIQKMESLPVGDDLPSLQNLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LEAWLTEKEEALNKVQTGNFKDQKELGVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LSNPKASEKMNSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVHVRE
QGMIKKPKQELPPPPPPKKRQIHVDVEAKKKFDATSAELQSWILRSKAALQNTEMNEYKK
SQETSGVRKKWKGLEKEQKEKIPQLDELNQTGQILQEQMGKEGLLAEEINDVLERVLLEW
KMISQQLEDLGRKIQLQEDINAYFRQLDALEKTIRAKEEWLRDASFSESPQRSLPSLKDS
CQRELTDLLGLHPRIEILCASCSALRSQPSVPGFVQQGFDDLRRHYQAVQKALEEYQQQL
ENELKSQPEPAYLDTLNTLKKMLSESEKAAQASLSALNDPSAVEQALQEKKALDETLENQ
KPTLHKLSEETKALEKNMLPDVGKTYRQEFDDAQGKWNKVKTKVSRDLRSLEEIIPRLRD
FKADSEVIEKWTNGVKDFLMKEQAAQGDTTALQRQLDQCTTFANEIETIESSLKNLRDIE
TSLQRCPVTGVKTWVQTRLADYQSQLEKFSQEIDIQKSRLSDSQEKAMNLKKDLAEMQEW
MAQAEEDYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDSIKLVAARVPSGG
QELTSEFNEVLESYQLLCNRIRGKCHTLEEVWSCWVELLHYLDLETAWLNTLEERMQSTE
ALPERAEAVHDALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEE
LSHLAESKQISLEKQLQVLRETDHMLQVLKESLGELDKQLTTYLTDRIDAFQLPQEAQKI
QAEISAHELTLEELKKNVRPQPPTSPEGRTTRGGSQMDLLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLSVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLSRKLKKEAAILSEWL
STTEAELVQKSASEGVIGDLDTEISWAKNILKDLEKRKVDLNTITESSAALQHLVVGSES
VLEDTLCVLNAGWSRVRTWTEDWRNTLLNHQNQLEVFDGHVAHISTCLYQAEALLDEIEK
KPASKQEEIVKRLLSELSDASIQVENVREQAIVLVNARGSSSRELVEPKLAELGKNFEKV
SQHINSAQMLIGQDPAGTVEAVGPFSDLESLESDIENMLKVVEKHLDPSNDEKMDEERAQ
IEEVLQRGEHLLHEPMEDSKKEKIRLQLLLLHTRYNKIKAIPQRKTIPLSSGIMSSALPA
DYLVEINKILLTLDDIELSLNIPELNTTVYEDFSFQEDSLKRIKDQLDRLGEQLAAVHEK
QPDVILEASGPEAIQIRDMLSQLNAKWDRVNRLYSDRRGSFARAVEEWKQFHCDLDDLTQ
WLSEAEDLLVGTCAPDGSLDLEKARTHQLELEDGLSSHQPCLIDVNQKGEDIVQRLRPSD
ASFLKDKLASLNQRWSALVAEVKDLQPRLKGESKQVSGYRKRLDEVVCWLTKVENSVQKR
STPDPEENPWELTDLAQEMDAQAENIKWLNRAELEMLSDKNLSLCERDNLSESLRNVNTM
WTKICREVPSLLKTRTQDPCSAPQTRIAAHPNVQKVALVSSASDAPLRGPEISVPADLDK
TITELADWLVLIDQMLKSNIVTVGDVKEINKTVSRMKITKADLEQRHPQLDFVFTLAQNL
KNKASSSDLRTAITGKLEKLKTQWESTQHGVELRRQQLEDMVVDSLQWDDHREETEELMR
KHEARFYMLQQARRDPLSKQVSDNQLLLQELGSGDGVIMAFDNVLQKLLEEYSSDDTRNV
EETTEYLKTSWINLKQSIADRQSALEAELRTVQTSRRDLENFVKWLQEAETTANVLADAS
QRENALQDSVLARQLRQQMLDIQAEIDAHNDIFKSIDGNRQKMVKALGNSEEATMLQHRL
DDMNQRWNDLKAKSASIRAHLEASAEKWNRLLASLEELIKWLNMKDEELKKQMPIGGDVP
ALQLQYDHCKVLRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRRNPQSKTELTPEER
AQKIAKAMRKQSSEVREKWESLNAVTSTWQKQVGKALEKLRDLQGAVDDLDADMKEVEAV
RNGWKPVGDLLIDSLQDHIEKTLAFREEIAPINLKVKTMNDLSSQLSPLDLHPSPKMSRQ
LDDLNMRWKLLQVSVEDRLKQLQEAHRDFGPCSQHFLSTSVQLPWQRSISHNKVPYYINH
QTQTTCWDHPKMTELFQSLGDLNNVRFSAYRTAIKIRRLQKALCLDLLELNTTNEVFKQH
KLNQNDQLLSVPDVINCLTTTYDGLEQLHKDLVNVPLCVDMCLNWLLNVYDTGRTGKIRV
QSLKIGLMSLSKGLLEEKYRCLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGEVAAFGG
SNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNIC
KECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVL
KNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPSQSPQLFHDDTHSR
IEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILK
SVEKEERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPLGSPPDSIVSPHHTSEDSE
LIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPDSDSRINGVSPWASPQH
PSLSYSLDPDPGPQSHQAASEDLLAPPHDTSTDLTDVMEQLNSTFPSCSPNVPSRPQAI
NT seq 10260 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtacgggcaccttgaagccagccctgatgatgggcagaatcagttcagtgat
atcattaagtccagatctgatgaacacaacgatgtacagaagaaaacctttaccaaatgg
ataaacgctcgattttcaaagagtgggaaaccacccatcaatgatatgttctcagacctc
aaagatgggagaaagctcttggatcttctagaaggcctcacaggaacatcattgccaaag
gaacgtggttccacaagggtgcatgccttaaataatgtcaaccgggtgctgcaggtttta
catcagaacaatgtggagctggtgaatatcggaggcactgacattgtggatggaaatccc
aagctgacgctgggtttgctgtggagtattattctgcactggcaggtgaaggatgtcatg
aaagatatcatgtcagacctgcagcagacgaacagcgagaagatcctgctgagctgggta
cggcagaccaccaggccctacagccaagtcaacgtcctcaacttcaccaccagctggaca
gatggactcgcattcaacgccgtgctccaccggcacaaaccagatctcttcagctgggac
agagtggtcaaaatgtccccaactgagagacttgaacatgcttttagcaaggcccatact
tatttggggattgaaaaacttctggatcctgaagatgttgccgtgcagctccctgacaag
aaatccataattatgtatttaacgtctctgtttgaggtgcttcctcagcaagtcactata
gacgccattcgagaggtggagacgctccccaggaagtacaagaaagaatgtgaaggggaa
gaaattaatatccagagtgcagtgctgacagaggaaggccagagtccccgagctgagacg
cccagcacagtcaccgaggttgacatggatttggacagctaccagatagcactagaggaa
gtactgacatggctgctgtctgcggaggacacgttccaggagcaagatgacatttctgat
gatgtcgaggacgtcaaagagcagtttgctacccatgaaacatttatgatggagctgagt
gcgcaccagagcagcgtggggagtgtcctgcaggctggcaaccaactgatgacacaaggc
actctgtcggatgaggaggagtttgagattcaggagcagatgaccttgctgaacgccaga
tgggaggcgctccgggtagagagcatggagagacagtcccggttgcatgatgccctgatg
gaactgcagaagaaacagctgcagcagctctcaggctggctgaccctcacagaggagcgc
attcagaagatggaaagcctcccagtgggtgacgacctaccctccctgcaaaacctgctt
gaagaacataaaagtttgcaaagtgacctcgaagctgagcaggtgaaggtgaattcctta
actcatatggtggtgattgtggatgaaaacagtggggagagcgccacagctgttttggaa
gatcagttacagaaactgggtgagcgctggacagctgtatgccgctggactgaagaacgt
tggaacaggttgcaagaaatcaatattttgtggcaggaattattggaagaacagtgtctt
ttggaagcttggctcaccgaaaaggaagaggctttgaataaagtccaaactggcaacttt
aaagaccagaaggaactcggtgtcagtgtccggcgtctggctattttgaaggaagacatg
gaaatgaagaggcagactctggaccaactgagtgagattggccaagacgtgggccaattg
ctcagtaatcccaaggcatctgagaagatgaacagcgactctgaggagctaacccagaga
tgggactctttggttcagagactagaagactcttctaaccaggtgactcaggctgtagca
aagctcggcatgtcccagattcctcagaaggatcttttggagaccgttcatgtaagagaa
caaggaatgataaagaagcctaagcaggagctgcctcctcctcccccaccgaagaagaga
cagatccacgtggatgtggaggccaagaaaaagtttgatgccacaagtgcagaactgcag
agctggattttgagatcaaaggctgccctccagaacacagagatgaacgagtataagaag
tcgcaggagacctcgggagtgagaaagaaatggaagggattagaaaaagaacaaaaggaa
aagatcccccagctggatgaactgaatcaaaccggacaaatccttcaggagcaaatggga
aaagaaggccttttggctgaagaaataaacgacgttctggaaagggttttgttggagtgg
aagatgatctctcagcagctggaagatctgggaaggaagatccagctgcaggaggatata
aatgcttattttaggcagcttgatgctctcgaaaagaccatcagggcgaaggaagagtgg
ctgagggatgcatccttttctgaatcaccccagcggtctttgccaagcttaaaggattcc
tgccagagggaactgacagacctccttggccttcaccccagaattgagatactgtgtgca
agctgttcagccctgaggtctcagccctctgtcccaggttttgtccagcagggttttgat
gaccttcgacgtcactaccaggctgtgcagaaggctttagaggaataccaacaacagcta
gaaaatgagctgaagagccagcctgaacctgcgtatttggacacactgaacactctgaaa
aaaatgctaagcgagtcagaaaaagcagcccaggcctctctgagtgccctgaacgatccc
tcagcggtggagcaggccctgcaggagaaaaaggcccttgatgaaacccttgagaatcaa
aaacctacattgcataaactttcagaagaaacgaaggctttggagaaaaatatgcttcct
gatgtggggaaaacgtacagacaagaatttgatgatgcccaaggcaaatggaataaagta
aagaccaaggtttccagagatttacgttcgcttgaggaaatcatccccagactcagagat
tttaaggctgattcagaagtcatcgagaagtggacgaatggcgtgaaagacttcctaatg
aaagagcaggctgcccaaggagataccactgccctgcagaggcagcttgaccaatgcacc
acatttgccaatgaaatcgaaacaatcgagtcatctctgaaaaacctgagggacatagag
actagccttcagaggtgtcccgtcactggagtcaagacatgggtacagacaagactagcg
gattaccaatcccaactggagaaattcagccaagagattgatattcaaaagagcaggttg
tctgacagtcaggagaaagccatgaacttgaagaaggatttggctgagatgcaggagtgg
atggctcaggccgaagaggactatctggagagggacttcgagtacaagtctccagaagaa
cttgaaagtgcagtggaggagatgaagagggccaaagaggacgtgctgcagaaggaggtg
agggtgaaaattctcaaggacagcatcaagctcgtggctgccagggtgccctctggtggc
caggagctgacatcggagttcaacgaggtgctggagagctaccagcttctctgtaatagg
attcgagggaagtgccacacactagaggaggtctggtcgtgttgggtggagctgcttcac
tatctggatctggaaaccgcgtggttgaacactttggaggagcgcatgcagagcacagag
gccctgcctgagagggcagaagctgttcacgacgctctggagtctcttgagtctgttttg
cgtcatccagcggataatcgcacccagattcgggaacttgggcagactctgattgatggt
gggatcctggatgacatcatcagcgagaagctggaggcttttaacagccgctatgaagag
ctgagtcacttggcggagagcaaacagatctctttggagaagcaactccaggtcctccgc
gaaactgaccacatgcttcaggtgctgaaggagagcctaggggagctggacaagcagctt
accacatacctgacggacaggattgatgccttccaactgccccaggaagctcagaagatc
caagcagaaatctcagcccatgagctcaccctggaggagctgaaaaagaatgtccgccct
cagccccccacctcccctgagggcagaaccacaagaggagggagtcagatggacctgctc
cagaggaaactccgagaggtttccaccaaattccagcttttccagaagcccgcgaatttc
gagcagcggatgcttgactgcaagcgcgtgctggatggcgtgaaggccgagctccacgtc
ctcagtgtgaaggatgtggaccccgacgtcatccagacccacttggacaagtgcatgaaa
ctatataaaacgttgagcgaggtcaagcttgaagttgagactgtcatcaagacagggagg
cacattgtccagaagcagcagacggacaacccaaaaggcatggatgagcagctcacttct
ctgaaagtcctctacaatgacctgggtgcacaggtgacagaagggaagcaggacctggaa
agagcctcacagctgtccaggaagttgaagaaggaggctgccatcctctctgaatggctc
tctaccacagaggctgaactagtgcagaaatctgcctcagaaggggtgatcggtgacctg
gacacagaaatctcctgggctaaaaacattctcaaggatctggaaaagagaaaagttgac
ttaaacaccatcacagagagtagtgctgcccttcaacacttggtggtgggcagtgagtct
gttttagaagataccctatgtgtgctcaacgctgggtggagccgagtccgcacgtggacc
gaggactggcgtaataccttgctgaaccaccagaaccagctggaggtctttgatggacat
gttgcccacatcagtacctgtctctatcaagccgaagctctattggatgagatcgaaaag
aaaccggcgagtaaacaggaagaaatcgtgaagcgtttactgtcagaactgagtgatgcc
agcatccaggttgagaatgttcgggaacaagccatcgtcctggtgaatgctcgtggaagc
tccagcagggaacttgtggaaccaaaattagctgaactgggcaagaactttgaaaaggtg
tcccagcacataaacagtgcccaaatgctgattggtcaggatcctgctggaactgttgaa
gctgttgggcctttctctgacttggaaagcttagagagtgacatagaaaacatgttgaaa
gttgtggaaaagcacttggaccccagtaatgatgagaagatggatgaggagcgagcccag
attgaggaagttctacaaagaggggagcatttgttacatgaaccaatggaggacagtaag
aaagaaaagatccgtttgcagttactacttttgcatacacgttacaacaaaatcaaggca
atcccgcagagaaaaacaattccgctttcttctggaattatgtcatctgccctccctgcg
gattatctggttgaaattaataaaattttgctcactctagatgacattgaattatcgctt
aatattcctgaactaaacaccactgtctacgaagacttctctttccaggaagactctctg
aagagaatcaaagatcagctggacagactcggagagcagctcgcagcagttcatgagaag
cagcccgatgtcatcctcgaagcctctggtcccgaagccattcagatcagggacatgctc
tctcagctgaacgcaaagtgggacagagtgaataggttatacagcgaccggagagggtcc
ttcgccagggctgtggaagaatggaagcagttccactgtgaccttgatgacctcacgcag
tggctgtctgaagctgaggacctgctggtaggcacttgtgctccagatggcagcctggac
ctggagaaagctaggacacaccagctggaactggaagacggcctcagcagccaccagccc
tgcttgattgatgtaaaccaaaagggagaagacattgtacagagactccgcccctcagat
gcaagctttctgaaggataaactggccagtttaaaccagcgctggagtgctcttgtagct
gaggtgaaggatctgcagcccaggctaaaaggagaaagtaagcaggtgtcggggtacagg
aaacggctggatgaggtcgtctgctggttaacaaaagtggagaactcggtgcagaagaga
tcaacccctgacccggaagaaaacccgtgggaattaacagatttagcccaagagatggac
gctcaggctgaaaacattaagtggctgaacagagccgaactggaaatgctttcagacaaa
aatctgagtttgtgcgagagagataatctttcagaaagcttgaggaatgtaaatacaatg
tggaccaagatatgcagagaggtgcctagcctactgaagacacgcacccaagacccctgc
tctgccccacagacaaggattgctgctcatcccaatgtccaaaaggtggcgctagtatca
tctgcatcggatgctcctctgcgtggccccgagatctcagttcctgctgatttggataaa
accatcaccgaactggctgactggctggtgttgatcgaccaaatgctgaagtccaacatt
gtcactgtgggggacgtgaaggagatcaataagacagtttcccggatgaaaatcacaaag
gctgacttagaacagcgccatcctcagctggattttgtattcacattggcccagaatttg
aaaaacaaagcttccagttcagatttgagaacagcaatcacgggaaaattggaaaagctg
aagacccagtgggagagtacccagcatggcgtggagctgcggcggcagcagttggaggac
atggtcgtggacagcctgcagtgggacgaccacagagaagagacggaagagctcatgagg
aaacacgaggcccgcttctacatgcttcagcaggcccgccgggacccgcttagcaaacaa
gtttctgacaatcaactcttgcttcaagaactgggttctggcgatggtgtcatcatggca
tttgataacgtcctgcagaaacttctggaagaatacagtagtgatgacaccaggaatgtg
gaagaaaccacagagtacttgaaaacgtcatggatcaatctcaaacaaagcattgctgat
agacagagtgccttggaggctgagctgcggacagtgcagacgtctcgtagagacctggag
aactttgtcaagtggcttcaggaagcagaaaccacagcaaatgtgctggccgatgcctct
cagcgggagaatgctcttcaggacagtgtcctggccaggcagctcagacagcagatgctg
gacatccaggcagaaattgatgcccacaatgacatatttaaaagcatcgatgggaacagg
cagaagatggtgaaggctctggggaattctgaggaggccacaatgcttcagcatcgcctg
gatgacatgaaccaaagatggaatgatctgaaggcaaaatctgccagcatcagggcccat
ttggaggccagtgctgagaaatggaacaggttgctggcatcgctggaagagctgatcaaa
tggctcaacatgaaagacgaagagcttaagaagcagatgcccattggaggggacgttccc
gccttacagctccagtatgaccactgcaaggtgctgagacgtgagctaaaggagaaagaa
tattctgtgctgaacgccgtagatcaagctcgagtgtttctggctgatcagccgatagag
gcccctgaagaacccagaaggaacccacagtcaaagacagagttgactccggaggagaga
gcccagaagatcgccaaggccatgcgcaaacagtcctctgaagtcagagagaagtgggag
agtctaaatgctgtgactagcacctggcaaaagcaagtaggaaaggcgttagagaaactc
cgagaccttcagggagccgtggatgacctcgacgcggacatgaaggaggtggaggccgtg
cgcaatggctggaagcccgtgggggacctgcttatcgactcgctgcaggatcacatagag
aaaaccctggcgtttagagaagaaattgcaccaatcaatctaaaagttaaaacaatgaat
gacctgtccagtcagctgtccccactcgacctgcatccgtctccaaagatgtctcgccag
ctggatgacctcaatatgcgatggaaacttctccaggtttcggtggaggatcggctcaag
cagctccaggaagcccacagagattttgggccatgttcccaacactttctgtccacttca
gtccagctgccgtggcagagatccatttcgcataataaagtgccctattacatcaaccat
caaacacagacaacctgttgggatcatcctaaaatgactgaactctttcaatcccttggt
gatctgaataatgtacgtttctctgcctaccgcacagccatcaaaatccgaaggctgcag
aaagcactatgcttggatctcttagaactgaacacaacaaatgaagttttcaagcagcac
aaactgaatcaaaatgatcagctcctgagtgtcccagatgtcatcaactgtctgaccaca
acttacgatgggcttgaacaactgcacaaagacttggtcaatgttccactctgcgtcgat
atgtgtctcaactggctgctcaacgtatatgacacgggccggactggaaaaattagagta
cagagtctgaagattggattgatgtctctctccaaaggcctcttagaagaaaaataccga
tgtctctttaaggaggtggcagggccaacagagatgtgcgaccagcggcagcttggcctg
ctacttcacgatgccatccagatcccgaggcagctgggggaagtagcagcctttgggggc
agtaacattgagcccagtgtccgaagctgtttccagcagaataacaacaagccagaaatc
agtgtgaaggagtttatagactggatgcggttggagccacagtccatggtgtggttgccg
gttctgcaccgtgtggcagctgcagagactgcaaaacatcaggccaaatgcaacatctgc
aaagaatgtccgatcgttgggttcaggtacaggagcctaaagcatttcaactatgacgtc
tgccagagctgcttcttttccggaagaacagccaagggccacaaattacattacccaatg
gtggaatactgtataccaacaacatctggggaagacgtgcgagatttcacaaaagtactg
aagaacaagttcaggtccaagaagtattttgccaaacacccccggcttggctacctgcct
gtccagaccgtgctcgaaggagacaacttagagactcctatcacgctcatcagtatgtgg
ccagagcactatgacccctcccagtcccctcagctgtttcatgatgacactcactcaaga
atagagcaatacgccacacgactggcccagatggaaaggacaaatggatccttcctaact
gacagcagctctaccacgggaagtgtggaggacgagcatgccctcatccagcagtactgc
cagacgctgggcggggagtctcctgtgagccagccacagagtccagctcagatcctgaag
tctgtggagaaggaagagcgtggggaactggagcggatcattgctgacttggaggaagag
caaagaaatctgcaggtggagtatgagcagctgaaggagcaacacctaagaaggggtctc
cccctgggctcccctccagactccattgtatcccctcaccacacgtccgaggactcggaa
ctgatagcggaagctaaactccttcggcagcacaaagggcggctggaggcgaggatgcag
attctggaagatcacaataaacagctggagtctcagctgcatcgcctcagacagctcctg
gagcagcctgactctgattcccgcatcaatggtgtctccccctgggcttccccacagcat
ccttcattgagctactcgcttgaccccgacccaggcccacagtcccaccaggcagcatct
gaggacctgctggccccgcctcatgacaccagcacggacctcacagatgtgatggagcag
ctcaacagcacgtttccctcctgcagcccaaatgtccccagcaggccacaggcaatttga

DBGET integrated database retrieval system