KEGG   Rattus norvegicus (rat): 25613
Entry
25613             CDS       T01003                                 

Gene name
Ptprz1, PTPzeta-A, PTPzeta-B, PTPzeta-S, Ptpz, RPTPbeta
Definition
(RefSeq) protein tyrosine phosphatase, receptor type Z1
  KO
K08114  receptor-type tyrosine-protein phosphatase zeta [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25613 (Ptprz1)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    25613 (Ptprz1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     25613 (Ptprz1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    25613 (Ptprz1)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Others
   25613 (Ptprz1)
SSDB
Motif
Pfam: Y_phosphatase Carb_anhydrase fn3 DSPc Y_phosphatase3 Peptidase_C10 PTPlike_phytase Glyco_hydro_36N Orf78
Other DBs
NCBI-GeneID: 25613
NCBI-ProteinID: NP_037212
RGD: 3455
Ensembl: ENSRNOG00000006030
UniProt: Q62656 F1LMY3
Structure
PDB: 
6J6U

Position
4q22
AA seq 2316 aa
MRILQSFLACVQLLCVCRLDWAYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPICNSPK
QSPINIDEDLTQVNVNLKKLKFQGWEKPSLENTFIHNTGKTVEINLTNDYYLSGGLSEKV
FKASKMTFHWGKCNVSSEGSEHSLEGQKFPLEMQIYCFDADRFSSFEETVKGKGRLRALS
ILFEIGVEENLDYKAIIDGTESVSRFGKQAALDPFILQNLLPNSTDKYYIYNGSLTSPPC
TDTVEWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLITWERPRVVYDTMIEKFAVLYQPLEGNDQTK
HEFLTDGYQDLGAILNNLIPNMSYVLQIVAICSNGLYGKYSDQLIVDMPTEDAELDLFPE
LIGTEEIIKEEDYGKGNEEDTGLNPGRDSATNQIRKKEPQVSTTTHYNHMGTKYNEAKTN
RSPTKGSEFSGKSDVLNTSLNPTSQQVAEFNPEREMSLPSQIGTNLPPHSVEGTSASLNS
GSKTLLVFPQMNLSGTAESLNMVSITEYKEVSADLSEEENLLTDFKLDSGADDSSGSSPA
SSTVPFSTDNLSHGYTSSSDTPEAVTYDVLRPESTRNALEDSAPSGSEESLKDPSLEGSV
WFPGSTDLTTQSETGSGREGFLQVNSTDFQVDESRETTETFSPDATASRGPSVTDMEMPH
YSTFAYPPTEVTPHAFTPSSRPLDLAPTSNILHSQTTQPVYNGETPLQPSYSSEVFPLVT
PLLLDNQTLNTTPAASSSDSALHATPVFPSVGVSFDSILSSYDDAPLLPFSSASFSSDLF
HHLHTVSQTLPQVTSAAERDELSLHASLLVAGGDLLLEPSLVQYSDVMSHQVTIHAASDT
LEFGSESAVLYKTSMVSQIESPSSDVVMHAYSSGPETSYAIEGSHHVLTVSSSSAIPVHD
SIGVADQGSLLINPSHISLPESSFITPTASLLQLPPALSGDGEWSGASSDSELLLPDTDG
LRTLNMSSPVSVADFTYTTSVSGDDIKPLSKGEMMYGNETELKMSSFSDMAYPSKSTVVP
KMSDIVNKWSESLKETSVSVSSINSVFTESLVYPITKVFDQEISRVPEIIFPVKPTHTAS
QASGDTWLKPGLSTNSEPALSDTASSEVLHPSTQPLLYEAASPFNTEALLQPSFPASDVD
TLLKTALPSGPRDPVLTETPMVEQSSSSMSLPLASESASSKSTLHFTSVPVLNMSPSDVH
PTSLQRLTVPHSREEYFEQGLLKSKSPQQVLPSLHSHDEFFQTAHLDISQAYPPKGRHAF
ATPILSIDEPQNTLISRLVYSEDIFMHPEISITDKALTGLPTTVSDVLIATDHSVPLGSG
PISMTTVSPNRDDSVTTTKLLLPSKATSKPTHSARSDADLVGGGEDGDDYDDDDYDDIDS
DRFPVNKCMSCSPYRESQEKVMNDSDTQESSLVDQSDPISHLLSENTEEENGGTGVTRVD
KSPDKSPPPSMLPQKHNDGREDRDIQMGSAVLPHTPGSKAWAVLTSDEESGSGQGTSDSL
NDNETSTDFSFPDVNEKDADGVLEADDTGIAPGSPRSSTPSVTSGHSGVSNSSEAEASNS
SHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDNTSP
RVISTPPTPIFPISDDIGAIPIKHFPKHVADLHASNGFTEEFETLKEFYQEVQSCTVDLG
ITADSSNHPDNKHKNRYVNIVAYDHSRVKLTQLAEKDGKLTDYINANYVDGYNRPKAYIA
AQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPTDGSEEYGSFLVNQKNV
QVLAYYTVRNFTLRNTKIKKGSQKGRSSGRLVTQYHYTQWPDMGVPEYSLPVLAFVRKTA
QAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTE
EQYVFIHDTLVEAILSKETEVPDSHIHSYVNTLLIPGPSGKTKLEKQFQLLSQSNILQSD
YSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPL
LHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMSEEHKCL
SNEEKLIVQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEEAANRDGPM
IVHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFTDIEQYQFLYKVV
LSLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
NT seq 6951 nt   +upstreamnt  +downstreamnt
atgcgaatcctgcagagcttcctcgcgtgcgttcagctactgtgcgtgtgtcgcctggac
tgggcttatggatactacagacaacagagaaaacttgttgaagagattggctggtcctat
acaggagcactaaatcaaaaaaattggggaaagaaatatccaatatgtaatagcccaaag
cagtctcctattaatattgatgaagatcttacacaagtaaatgtgaatcttaagaaactg
aaatttcagggttgggaaaaaccatccttggaaaacacgtttattcacaacactgggaaa
acagtggaaataaatctcaccaatgactactatctcagtggaggactttcagaaaaggtc
ttcaaggcaagcaaaatgacttttcactgggggaaatgcaatgtgtcatcggaaggatcg
gaacacagcttagaagggcagaagtttccactcgagatgcaaatctactgcttcgatgcg
gaccgattttcaagttttgaggaaacagttaaaggaaaaggaaggttaagggctctatcc
attttatttgagattggagttgaagaaaatttggattacaaagccattattgatgggact
gaaagtgttagtcgttttggaaagcaggctgccttagatccgttcatcttgcagaacctc
ctgccaaactccactgacaagtactacatttacaacggatcactgacatcccctccctgc
acagacaccgtcgaatggattgtttttaaggatacagttagcatctctgaaagccagctg
gctgtattttgtgaagttctcacaatgcaacagtccgggtatgtcatgttgatggattac
ttacaaaacaatttccgagaacaacagtacaagttttccaggcaggtgttttcttcgtac
actgggaaggaagagattcatgaagcagtgtgcagttcagaaccagaaaatgtgcaagct
gaccctgagaattacaccagccttctgatcacatgggaaaggcctcgggttgtttatgac
acaatgattgagaagtttgcggttctgtaccagccactggagggaaacgaccaaaccaag
catgagtttttaacagatggctatcaggacttgggtgccattctcaataacttaatacct
aacatgagttatgtgctccaaatagtggccatatgctctaatggcctttatggaaagtac
agtgaccaattgatagtcgacatgcctactgaggatgctgaacttgacctctttcctgaa
ttaattggaactgaagaaataatcaaggaggaagactatggaaaaggcaatgaagaagac
actggcttgaatcccggtagagacagtgccacaaaccaaataaggaaaaaggaaccccag
gtttctaccacaactcactataatcacatggggactaaatataatgaagccaagactaac
cgatctccaacgaaaggatctgaattctctggaaagagtgatgttctcaacacatccctg
aatcctacttcccaacaggttgctgaattcaatccagaaagagaaatgtccttgccttct
cagattggaactaacctgccaccacacagtgtggaaggcacctcagcctccttaaacagt
ggctctaaaactctccttgtcttcccacagatgaacttgtctgggactgcagaatcctta
aatatggtttccataacagagtacaaagaggtgtctgctgacctcagtgaggaagaaaac
ttactgactgatttcaagctcgatagtggagcagatgattcgtcaggctctagccctgcg
tcctccactgtccccttttccacagataatctatcccatggatatacatcttcttcagat
acgcccgaggcggtcacgtatgatgtccttaggccagaatctacgagaaatgctctagag
gattcggctccatcaggttcagaagaatcactaaaggatccctctcttgaagggagtgtg
tggttccctggatccacagacctaacaacacagtctgagactggatctgggagagagggc
tttctccaagttaactccacggacttccaagttgatgaatcgagggagacaactgagaca
ttttctccagatgctaccgcgtcccggggtccttcggtcacagatatggaaatgccacat
tattctacctttgcctaccccccgactgaagtaacaccacatgctttcactccatcctcc
agaccacttgatttggctcccactagcaacatcctccattcgcagacaactcaaccagta
tacaatggtgagacacctcttcaaccttcctacagtagtgaagtctttcctctagtcacc
cctttgttgcttgacaatcagaccctcaacactacccctgctgcttcaagtagtgattcg
gccttgcatgctacgcctgtattccccagtgttggtgtgtcatttgactccatcctgtct
tcctatgatgatgcacctctgctcccattttcctctgcttccttcagtagtgacttgttt
caccatctgcatacggtttctcaaacccttccgcaagttacttcagctgctgagagggat
gagctgtctttgcatgcttctctgctggtggctgggggtgatttgctgttagagcccagc
cttgttcagtattctgatgtgatgtcacatcaggtcactattcatgctgcttcggacaca
ttggaatttggtagtgagtctgctgtcctttataaaacgtctatggtttctcaaatcgaa
tcacccagcagtgatgtcgttatgcatgcatattcgtcagggcctgaaacttcttatgcc
attgagggctcccaccacgtgctcactgtttcttccagttctgcaatacctgtgcatgat
tctattggtgtagctgatcaggggtccttacttatcaatcctagccatatatcactgcct
gagtcctcatttattactccaactgcatcattactgcagcttcctcctgccctctctggt
gatggggagtggtctggagcctcctctgatagtgaattgcttttacctgacacagatggg
ctgagaactcttaacatgtcttcacctgtttctgtagctgattttacatacacgacatct
gtgtctggcgatgatattaagccgctttctaaaggtgaaatgatgtatggaaatgagact
gaactgaaaatgtcttctttcagtgacatggcatacccttctaaaagcacagtcgtgcca
aagatgtctgatattgtaaataagtggagtgaatctttaaaagaaacctctgtttccgta
tctagcataaacagcgtgtttacagagtctctggtttatcccataactaaggtttttgat
caggagattagtcgagttccagagattatcttcccagttaaacctacacacacagcatct
caagcatctggtgacacttggcttaaacccgggcttagcacaaactcagagcctgcgctc
tctgacactgcttctagtgaagtattacacccttcaacacagcccttgctctatgaggcc
gcatctccttttaatacggaagcattgctgcaaccttcctttccggcttctgatgttgac
accttgcttaaaactgcccttccctctgggcctcgtgatccagtgctgactgaaaccccc
atggttgagcaaagtagctcttccatgtctcttcccctggcatcagagtctgcttcaagc
aaaagcacgctgcactttacatctgtaccagttctcaatatgtcaccttctgatgtgcac
cccacttcacttcaacgcttaacagttcctcactcgagggaggaatattttgaacaaggt
ttgcttaagagcaaaagtccccagcaagtcctgccgtccttgcacagccatgacgagttt
ttccaaactgcacatctggacattagccaggcctaccctccaaaaggaaggcatgcattt
gctactcctattttatcaatcgatgaaccacaaaatacacttataagcaggcttgtgtat
tctgaggacattttcatgcaccctgaaatttctattactgataaggcacttactggtcta
ccaacgaccgtttctgatgtacttatagctactgaccattctgttccattaggaagtggg
cccatttccatgacaactgtttctcccaacagagatgattctgtgaccacaaccaagttg
cttcttccttctaaagctacttctaagccgactcatagtgccagatctgatgccgattta
gtaggaggtggtgaagatggtgatgactatgatgatgatgattatgatgacatagatagt
gatcgctttcccgtaaataagtgtatgtcatgttcaccctatagagaatcacaggaaaag
gtaatgaatgactcggacacccaagaaagcagtcttgtggatcagagtgacccaatttca
catttgctctctgagaataccgaagaagaaaatggaggcacgggtgtaactagggtggat
aaaagtcctgataagtcaccaccaccaagtatgctaccccagaagcacaatgatggaaga
gaggaccgtgacattcagatgggtagtgctgtccttcctcacaccccaggatctaaagca
tgggcagttttgacaagtgatgaagagagtgggtcagggcaaggcacctcagatagcctt
aatgataatgagacttccacagatttcagtttcccagatgttaatgaaaaggatgctgat
ggtgtcctggaagcagatgacacaggcatagctccgggatctccacggtcctccacacca
tctgttactagtgggcattcaggagtatccaacagttcagaggcagaggccagtaatagt
agccatgagtctcgtattggtctagctgaggggttggagtctgagaagaaggcggttata
ccccttgtgatcgtgtctgccctgacttttatctgtctagtggttcttgttggtattctc
atctactggagaaaatgcttccagacggctcacttttatttagaagacaatacatcccct
cgagtaatatctacaccaccaacacccatctttccaatttcagatgatattggagcaatt
ccaataaagcattttccaaagcacgtagcagacttacatgcaagtaatgggttcactgaa
gaatttgagacactgaaagagttttaccaggaagtgcagagctgcactgttgacttaggt
attacagcagacagctccaatcacccagacaacaagcacaagaacagatatgtcaacatc
gtagcctatgatcatagcagggttaagctcacacaacttgctgaaaaagatggaaaactg
actgattacatcaatgccaattatgttgatggttacaacaggccaaaggcttacattgct
gcccagggtccactgaagtccacagcagaagatttctggagaatgatatgggagcataat
gtggaagtcatcgttatgataacaaacctcgtggagaaaggaagaagaaaatgtgaccag
tactggcctactgatggcagtgaagaatacgggagcttcctggtcaaccagaagaatgtt
caggtgcttgcttattatactgtgaggaatttcaccctaagaaacacaaagataaaaaag
ggctctcagaaaggaagatccagtggacgcctagtcactcagtatcattacacccagtgg
cctgatatgggtgttcccgagtactccctacccgtgctggcctttgtgaggaagactgct
caggccaagcgacatgcagtcgggccagttgttgtccactgcagcgctggcgtggggaga
acgggcacatacattgtactagacagtatgctacagcagattcaacacgaaggaaccgtc
aacatatttggtttcttaaaacacattcgttctcaaaggaattatttggtgcaaacagag
gagcaatacgtcttcattcacgacacactggttgaggccatactcagcaaagagacagag
gtgcctgacagccacatccattcctatgttaatacactcctcatacccggaccatcaggc
aagacaaaactagagaaacaattccagcttctgagtcagtcaaatattcttcagagtgac
tactccacggccctgaagcagtgtaacagggagaagaacagaacatcctccatcatcccc
gtggaaagatcgagggtgggcatttcatccctgagtggggaaggcacagactacatcaat
gcatcctatattatgggttattaccagagcaatgaattcatcatcacccagcaccccctt
ctacacaccatcaaggacttctggagaatgatatgggatcataatgcccagctggtggtt
atgattccagatggtcaaaacatggcagaggatgaatttgtttactggccaaataaagat
gagcccataaattgcgagagcttcaaagtcacgcttatgtctgaagaacacaaatgtctt
tcgaatgaggaaaaactgatagttcaagacttcatcttggaagcgacacaggatgattat
gtgctggaagtaaggcattttcagtgcccgaaatggccaaatccagatagtcccattagt
aaaacatttgaacttataagtattatcaaagaagaagctgctaacagagatgggcccatg
attgttcacgatgagcatggaggagtaacagcagggacattttgtgctctcacaaccctt
atgcaccaactagaaaaagaaaactccatggatgtttaccaagtagccaagatgatcaat
ttgatgaggccgggagtcttcactgacattgagcagtaccagtttctctacaaagtggtc
ctcagcctggtcagcacaaggcaggaagagaatccatccacctccctggatagtaatggt
gcagctttgcctgatggaaatatagctgaaagcctggagtctttagtctga

DBGET integrated database retrieval system