KEGG   Rattus norvegicus (rat): 25692
Entry
25692             CDS       T01003                                 

Gene name
Plat, PATISS, tPA
Definition
(RefSeq) plasminogen activator, tissue type
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno04610  Complement and coagulation cascades
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25692 (Plat)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25692 (Plat)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25692 (Plat)
  09162 Cancer: specific types
   05215 Prostate cancer
    25692 (Plat)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25692 (Plat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25692 (Plat)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25692 (Plat)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     25692 (Plat)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   25692 (Plat)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   25692 (Plat)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF EGF_2
Other DBs
NCBI-GeneID: 25692
NCBI-ProteinID: NP_037283
RGD: 3342
Ensembl: ENSRNOG00000019018
UniProt: P19637
Position
16q12.5
AA seq 559 aa
MKGELLCVLLLCGVAFTLPDQGIHRRFRRGARSYRATCRDEQTQTTYQQHQSWLRPMLRG
NRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEGQGITYRGTWSTAENGAECINWNSSALSQKPYSARRPNAIKLGLGNHNYCRNPD
RDVKPWCYVFKAGKYTTEFCSTPACPKGPTEDCYVGKGVTYRGTHSFTTSKASCLPWNSM
ILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKQPQFRIKGGLFTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFVER
FPPHHLKVVLGRTYRVVPGEEEQTFEIEKYIVHKEFDDDTYDNDIALLQLRSDSSQCAQE
SSSVGTACLPDPDVQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTITSNMLCAGDTRTGGNQDVHDACQGDSGGPLVCMIDKRMTLLGIISWGLGCGQKDVP
GIYTKVTNYLNWIQDNMKQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaagggagagctgttgtgcgtcctgctgctttgtggagtggcgttcacgttgcctgac
cagggaatacacaggaggttcagaagaggagctcggtcctacagagcgacctgcagagat
gaacagactcagacaacttaccaacagcatcagtcatggctacgtcccatgctcagaggc
aatcgggtggaatactgccggtgcaacagcggcctggcacagtgccactcggtgcccgtc
cgaagttgcagtgaaccgagatgcttcaatgggggtacgtgtcagcaggccctgtatttc
tctgacttcgtctgccagtgccctgacggatttgttgggaaacgctgtgatatagatacc
agagcaacctgcttcgagggccagggcatcacctacagaggcacatggagcacagcagaa
aatggggctgaatgcatcaactggaatagcagtgccctgtcccagaagccctacagtgca
aggaggccaaatgccatcaagctgggccttgggaatcacaattactgcagaaacccagac
cgagacgtgaagccctggtgctatgtctttaaggcagggaagtataccacggagttctgc
agcacgccggcttgccctaagggaccaactgaggactgctatgttggaaaaggtgtgact
taccgtggcacccacagctttaccacatccaaggcctcctgcctcccatggaattccatg
atcctgataggcaagacttacacagcgtggagggccaactcccaggcacttggcctgggc
agacacaattattgccggaacccagatggggatgccaaaccttggtgccacgtgatgaag
gaccgaaagctgacatgggaatattgcgacatgtccccatgctccacctgcggcctgagg
caatacaaacagcctcagtttcgaattaaaggaggactcttcacagacatcacctcacac
ccttggcaggccgccatctttgtcaagaacaagaggtctccaggagagagattcctgtgt
ggaggggtgctgatcagttcctgctgggtgctatctgccgcccactgctttgtagagagg
tttccaccccatcatcttaaagtggtcttgggcagaacatacagagtggtccctggagag
gaggagcagacattcgagatcgaaaagtacatagtccataaggaatttgatgacgacact
tatgacaatgacatcgcattactgcagctgaggtcagattccagtcagtgtgcccaggag
agcagttctgtcggcactgcctgcctccctgaccccgacgtacagctccctgactggaca
gagtgtgagctttctggctacggcaagcatgaggcatcctctcctttcttctctgaccgg
ctgaaggaggctcacgtcagactgtatccgtccagccgctgtacctcacagcatctgttt
aacaaaaccatcacgagcaacatgctgtgtgcaggagacacccgaactgggggcaaccaa
gacgtccatgacgcgtgccagggtgactcaggaggccctctggtgtgcatgatcgataag
cggatgactttactgggcatcatcagctggggcctcggctgtgggcagaaggacgtgcca
gggatatacacaaaggtcactaattacctgaactggatccaagacaacatgaagcaatga

DBGET integrated database retrieval system