KEGG   Rattus norvegicus (rat): 25740
Entry
25740             CDS       T01003                                 

Gene name
Gnaz
Definition
(RefSeq) guanine nucleotide-binding protein G(z) subunit alpha
  KO
K04535  guanine nucleotide-binding protein G(z) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    25740 (Gnaz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    25740 (Gnaz)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    25740 (Gnaz)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16
Other DBs
NCBI-GeneID: 25740
NCBI-ProteinID: NP_037321
RGD: 2717
Ensembl: ENSRNOG00000001313
UniProt: P19627
Position
20
AA seq 355 aa
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERIAAPDYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLSEKIRRIPLSVCFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggatgtcggcaaagctcagaggaaaaagaggcagcgcggcggtcgaggagaattgac
cgccacctgcgctcggagagccagcggcagcgccgtgagatcaaacttctcctgctgggc
accagcaactcgggcaagagcaccatcgtcaagcagatgaaaatcatccacagcggtggt
ttcaacctggaggcctgcaaggagtacaagcccctcatcatctacaacgccatcgactcg
ctgacccgcatcattcgggccctggctgccctgaagattgatttccacaaccctgaccgt
gcctacgacgccgtgcagctctttgccctgactggcccggcagagagcaagggtgagatc
acgcccgagctgctgggtgtcatgcgacggctctgggctgaccccggggcccaggcctgc
ttcggccgctccagcgagtaccacctggaggacaacgccgcttactacctgaatgacctg
gagcgcatcgcggcgcccgactatatccccacggtggaggacatcctgcgctctcgggac
atgaccacgggcattgtggaaaacaagttcaccttcaaggagcttaccttcaagatggtg
gatgtgggagggcagaggtcagagcgcaaaaaatggatccactgctttgagggcgtgacg
gccatcatcttctgtgtggagctcagtggctatgacctgaagctttatgaggacaaccag
acgagccgaatggcggagagcctgcgtctttttgactccatctgcaacaacaactggttc
atcaacacctccctcatcctcttcctgaacaagaaggacctcctgtcggagaagattcgg
cgtatcccgctcagcgtctgcttccccgagtacaagggtcagaacacgtacgaggaagcc
gcggtctacatccagcgtcagttcgaggacctaaaccgaaacaaggagaccaaggagatc
tactcgcactttacctgtgccaccgacaccagtaacatccagtttgtcttcgacgcagtg
acagatgtcatcatacagaacaatctcaagtacattggcctttgctga

DBGET integrated database retrieval system