KEGG   Rattus norvegicus (rat): 259275
Entry
259275            CDS       T01003                                 

Gene name
Ostf1, Sh3d3
Definition
(RefSeq) osteoclast stimulating factor 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ank_5 Ank_2 SH3_1 Ank_4 SH3_9 Ank SH3_2 Ank_3
Other DBs
NCBI-GeneID: 259275
NCBI-ProteinID: NP_683690
RGD: 628849
Ensembl: ENSRNOG00000012156
UniProt: Q6P686
Position
1q43
AA seq 214 aa
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTSWWKGTCKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEVLFTQPNVELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNNEKKLALDMA
TNAACASLLKKKQATDGARTLSNAEDYLDDEDSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtccaagccacctcccaaaccggtcaaaccagggcaagttaaagtcttcagagctcta
tatacgtttgaaccgagaactccagatgaattatacttcgaagaaggagatattatctac
atcactgacatgagcgacaccagctggtggaaaggaacatgcaaaggcagaacaggactg
atcccaagcaactatgtggctgagcaggcagaatccattgacaatccattgcatgaggct
gcaaaaagaggcaacttgagctggctgagggagtgcttggacaaccgagtgggcgtgaac
ggcctggacaaggctggaagcacagccctgtactgggcctgccacggtggccacaaagac
atagtggaggttctgtttactcagccgaatgtggaactgaaccagcagaacaagctggga
gacacggctctgcacgcagctgcctggaagggttatgcagacattgtccagttgctacta
gcaaaaggcgcgaggacagacttgagaaacaatgagaagaagctagccttggacatggcc
accaacgctgcctgtgcatcgctcctgaagaagaagcaggcaacagatggggctcgaacg
ttaagcaatgctgaggactacctcgatgatgaagactcagactga

DBGET integrated database retrieval system