KEGG   Rattus norvegicus (rat): 26954
Entry
26954             CDS       T01003                                 

Gene name
Rheb
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04218  Cellular senescence
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    26954 (Rheb)
   04151 PI3K-Akt signaling pathway
    26954 (Rheb)
   04152 AMPK signaling pathway
    26954 (Rheb)
   04150 mTOR signaling pathway
    26954 (Rheb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26954 (Rheb)
  09143 Cell growth and death
   04218 Cellular senescence
    26954 (Rheb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    26954 (Rheb)
   04919 Thyroid hormone signaling pathway
    26954 (Rheb)
  09149 Aging
   04211 Longevity regulating pathway
    26954 (Rheb)
  09159 Environmental adaptation
   04714 Thermogenesis
    26954 (Rheb)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    26954 (Rheb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    26954 (Rheb)
   05163 Human cytomegalovirus infection
    26954 (Rheb)
   05165 Human papillomavirus infection
    26954 (Rheb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    26954 (Rheb)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    26954 (Rheb)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14
Other DBs
NCBI-GeneID: 26954
NCBI-ProteinID: NP_037348
RGD: 621840
Ensembl: ENSRNOG00000050578
UniProt: Q62639
Structure
PDB: 
2L0X

Position
4
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcctcagtccaagtcccggaagatcgccatcctgggctatcggtctgtgggaaagtcc
tcattgacaattcagtttgttgaaggtcaatttgttgattcctacgatccaaccatagaa
aacacattcaccaagctgatcacagtaaatgggcaagagtatcatcttcagcttgtagac
acagcagggcaggatgaatattccatttttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagctttgaagtaattaaagttatccac
ggcaagctgttggacatggtggggaaagtgcagataccgattatgttagtcggaaataag
aaggacctgcatatggaaagggtgatcagttatgaagaaggaaaggctttggcagaatct
tggaatgcagcttttttggaatcttctgcaaaagaaaatcagactgctgtggatgttttt
agaaggataattttggaagcagaaaagattgacggagcggcttcacaagggaagtcttcg
tgctcggtgatgtga

DBGET integrated database retrieval system