KEGG   Rattus norvegicus (rat): 287276
Entry
287276            CDS       T01003                                 

Gene name
Sar1b, SARA1B, Sara2
Definition
(RefSeq) secretion associated, Ras related GTPase 1B
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    287276 (Sar1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    287276 (Sar1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287276 (Sar1b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    287276 (Sar1b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     287276 (Sar1b)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    287276 (Sar1b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    287276 (Sar1b)
SSDB
Motif
Pfam: Arf G-alpha SRPRB Roc MMR_HSR1 Ras GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 287276
NCBI-ProteinID: NP_001009622
RGD: 1305590
Ensembl: ENSRNOG00000004820
UniProt: Q5HZY2
Position
10q22
AA seq 198 aa
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHLQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtccttcatatttgactggatttacagtggtttcagcagtgtgctgcagtttctagga
ttgtataaaaaaactggtaaactggtattccttggattggataatgccgggaaaacaacg
ttgctacacatgctgaaagatgacaggcttggccagcacgtcccaacactacatcccact
tcagaggagctcactattgctggcatgacgtttacaacttttgatctgggtgggcatttg
caagcccgaagagtatggaaaaactaccttcctgctatcaatggcattgtatttcttgtg
gattgtgcagaccatgaaaggctgttagaatcaaaagaagaacttgattcactaatgaca
gatgaaaccattgccaacgtgcctatcctaattcttggaaacaagatcgacaggcctgaa
gccataagtgaagagaggttacgagagatgtttggtttatatggtcagacaacaggaaag
ggcagtgtgtcactgaaggagctgaatgcccggcctctggaagtgttcatgtgcagtgtg
ctaaaaaggcagggctacggggaaggcttccgctggatggcgcagtacatcgactag

DBGET integrated database retrieval system