KEGG   Rattus norvegicus (rat): 289623
Entry
289623            CDS       T01003                                 

Gene name
Ube2k, E2-25k, Hip2, Hypg, Lig
Definition
(RefSeq) ubiquitin-conjugating enzyme E2K
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    289623 (Ube2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    289623 (Ube2k)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     289623 (Ube2k)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   289623 (Ube2k)
SSDB
Motif
Pfam: UQ_con UBA Prok-E2_B RWD UEV UBA_3 UFC1
Other DBs
NCBI-GeneID: 289623
NCBI-ProteinID: NP_001099476
RGD: 1311626
Ensembl: ENSRNOG00000027088
UniProt: D3ZXS8
Position
14p11
AA seq 200 aa
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
VALSSKSWDVETATELLLSN
NT seq 603 nt   +upstreamnt  +downstreamnt
atggccaacatcgcggtgcagcgaatcaagcgggagttcaaggaggtgctgaagagcgag
gagacgagcaaaaatcaaattaaagtagatcttgtagatgagaattttacagaattaaga
ggagaaatagcaggacctccagacacaccgtatgaaggtggaagatatcaactagagata
aaaataccagaaacatatccatttaacccccctaaggtccggtttatcactaaaatatgg
caccctaatattagttccgtcacaggggctatttgtttggatatcctgaaagatcaatgg
gcagcagcaatgactctgcgcacagtattattgtcattgcaagcactgctggccgctgca
gaaccagatgacccccaagatgcagtagtagcaaatcagtacaaacaaaatcctgaaatg
ttcaagcagacagctcgactttgggcacacgtgtatgctggagcaccagtgtctagtcca
gaatacaccaaaaaaatagaaaacctctgtgctatgggttttgataggaacgcagtaata
gtggccttgtcttcaaaatcatgggatgtagagactgcaacagaactgcttctgagtaac
tga

DBGET integrated database retrieval system