KEGG   Rattus norvegicus (rat): 290774
Entry
290774            CDS       T01003                                 

Gene name
Adam24
Definition
(RefSeq) ADAM metallopeptidase domain 24
  KO
K08611  disintegrin and metalloproteinase domain-containing protein 24 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    290774 (Adam24)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     290774 (Adam24)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   290774 (Adam24)
SSDB
Motif
Pfam: Reprolysin ADAM_CR Disintegrin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Reprolysin_4 Reprolysin_2 EGF_2 Peptidase_M66 Peptidase_M57 Peptidase_M10
Other DBs
NCBI-GeneID: 290774
NCBI-ProteinID: XP_017443074
RGD: 1309066
Ensembl: ENSRNOG00000038671
UniProt: F1LW54
Position
16q12.1
AA seq 740 aa
MVTVREALVHARITLLQVWWRVLLFSSVWPMTLCTEHKAPPETVIPVRVIVSSKEMSLTG
WMSYSLHFGGHRHIISLKSKNFLVSRQLPVFTYSDQGVLFEDRPFVQTDCYYLGFVDEDP
ESMAALTTCFGGFQGILQINDTTYKIKPKTPSFTFEHLLYKIDSEETQLHPMRCGLTDEE
IAGQVRLQENDKSTLMQSIYGSWWSHGLYIKLALVIDHEQFLYRKSNTSLVLKDVFNIMN
GINLSLLSVDINVALLGLTIWTQRNPIPVQDIYTLLPAFCLWKTMNFNSQMAYDIAHLFV
NYTFGDYFGIAFVGTVCNKTFGCGVDRLFGDNFLTIGHIVAHEIGHNLGMPHDGILCSCG
EGPCLMSATMESSKKLSNCSYEFLWANIAKKSCLQREPSSSDIFPMKICGNGVVDDGEEC
DCGSQSCGRNSRCCLPTCILKSGAKCASGLCCNFKCQIQPSGTLCRTKENECDLPEWCNG
TSKECPEDTFVQAGTSCLGNGYCYEKRCNSHDDHCKRVFGEHAMKASDRCYKELNTRGDR
FGNCGLKNKGYVRCETSDILCGRIQCAKVKTFPILESHYTVHWTRFNDASCWSTDYHLGM
KIADLGDIKDGTNCGPQHVCISRKCVNKPSWKSDCSPETCNMRGICNNKQHCHCDFGWSP
PLCVDNGTGGSIDSGSPAPEDPNANKRKGIGKFIILLLPIIFVVVVLFLLFYLFRTNRLS
LGGDKQAKKGEEAKPPEEEA
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggtgactgtgagggaggctctggttcacgcaaggatcactctccttcaggtatggtgg
agggtgttgctcttttcctctgtatggcccatgactttgtgtactgaacacaaagcaccc
ccagagacagtgatacccgtgagggtaattgtctctagtaaagagatgagtcttacaggc
tggatgtcctacagtctgcactttggaggccacagacacattatctccttgaagtccaag
aactttttggtatcaagacagctccctgtgttcacatacagtgaccaaggtgttctcttt
gaggacagaccttttgtccagactgactgttactaccttggttttgtggatgaagatcca
gaatccatggctgctcttacaacctgttttgggggctttcaaggcatattacagataaat
gatacaacttataaaattaagcccaagaccccctctttcacatttgaacatctgctttac
aagatagacagtgaagaaactcaattacaccccatgagatgtggattaacagatgaagaa
atagcagggcaagtgagacttcaagaaaatgataagtccactctaatgcaaagcatctat
gggtcatggtggtctcatggattgtatattaaactggcattggttatagaccatgaacaa
ttcctttatcggaaaagtaacacttctcttgtgttaaaagatgtattcaacattatgaat
gggataaatctctccttactttcagttgatattaatgtggctttacttggtcttactatt
tggactcaacgaaatcccataccagtgcaagacatatatactctcttgccagcattttgt
ttgtggaagacaatgaactttaattctcagatggcatatgatattgcacatctcttcgtg
aattatacttttggtgactattttggcatagcctttgtgggaactgtatgcaataagaca
tttggttgtggagttgataggctctttggagacaatttccttaccattggacatattgtg
gcccacgagataggtcacaatttgggcatgccacatgatgggatactttgttcttgtgga
gagggaccatgtttgatgtctgctacaatggagagttccaaaaaactcagcaactgtagt
tacgaattcttgtgggccaacatagccaaaaaaagctgcctacagagggagcccagctct
tcagatatcttcccaatgaagatctgtgggaacggtgtagttgatgatggcgaggagtgt
gactgtggatctcaaagctgtggacgtaatagtaggtgttgtctgcctacctgtattctg
aagtctggagctaaatgtgcttctggactatgctgtaacttcaaatgccaaattcagcca
tctggcactctgtgtagaacgaaggagaatgaatgtgatcttccagaatggtgcaatggg
acttcaaaggagtgccctgaggatacatttgtacaggctgggacttcttgccttggtaat
ggctactgctatgaaaaaagatgtaatagccatgacgaccactgcaagagagtttttggc
gaacatgccatgaaagcatctgacagatgctacaaggagctcaatactcgtggtgatcgc
tttggtaactgtggactcaagaacaaggggtatgtgagatgtgagacctcagacatcctc
tgtgggaggattcagtgtgccaaagtgaaaacatttcctattctggaaagtcattacact
gttcactggactcgtttcaatgatgcttcctgctggagtaccgactaccacttggggatg
aaaatcgctgaccttggtgacataaaagatggcacaaactgtggtccacagcatgtgtgc
atcagcagaaagtgtgttaataagccaagttggaaaagtgattgttcaccagagacttgc
aacatgagaggaatctgcaataataaacagcactgtcattgcgattttggctggagccca
ccactctgtgtggacaatgggactggaggaagcattgacagtggcagtcctgcacccgag
gaccctaacgcaaacaaaaggaaaggcataggaaaattcataattttgctacttcctatt
atttttgtggttgtagttttgtttctattgttttacctgtttagaaccaatagactatca
cttggaggagataaacaggctaaaaaaggtgaagaggccaaacccccagaagaggaagca
taa

DBGET integrated database retrieval system