KEGG   Rattus norvegicus (rat): 29146
Entry
29146             CDS       T01003                                 

Gene name
Jag1
Definition
(RefSeq) protein jagged-1 precursor
  KO
K06052  jagged-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04371  Apelin signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04668  TNF signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29146 (Jag1)
   04371 Apelin signaling pathway
    29146 (Jag1)
   04668 TNF signaling pathway
    29146 (Jag1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    29146 (Jag1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29146 (Jag1)
  09162 Cancer: specific types
   05224 Breast cancer
    29146 (Jag1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29146 (Jag1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29146 (Jag1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29146 (Jag1)
CD molecules [BR:rno04090]
 Proteins
  29146 (Jag1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_3 EGF_CA cEGF DUF6479
Other DBs
NCBI-GeneID: 29146
NCBI-ProteinID: NP_062020
RGD: 2937
Ensembl: ENSRNOG00000007443
UniProt: Q63722
Structure
PDB: 
5UK5

Position
3
AA seq 1219 aa
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSESGGKFTCDCNKGFTGTYCHENINDCEGNPCTNGGTCIDGVNSYKCICSDGWE
GAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCICPPGHSGAKCHEVSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPR
PCRLHKGHGECPNGQSCIPVLDDQCFVRPCTGAGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSLSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRRKPSSHTHSAPEDNTTNNVREQLNQIKNPIEKHGANTVPIKDY
ENKNSKMSKIRTHNSEVEEDDMDKHQQKVRFAKQPVYTLVDREEKVPQRTPTKHPNWTNK
QDNRDLESAQSLNRMEYIV
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggccggccggggcgccccttgagccttctgctcgccctg
ctctgtgccctgcgagccaaggtgtgcggggcctcgggtcaatttgagctggagatcctg
tccatgcagaacgtgaacggagagttacagaatgggaactgttgcggcggagcccggaac
cctggcgaccgcaagtgcacccgcgacgagtgtgacacgtacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccgggggaccctgcagcttcggctcagggtctacgcct
gtcatcgggggcaataccttcaatctcaaggccagccgcggcaacgaccgtaatcgcatc
gtactgcctttcagtttcgcctggccgaggtcctacactttgctggtggaggcatgggat
tccagtaatgacactattcaacctgatagcataattgaaaaggcttctcactcaggcatg
ataaaccccagccggcagtggcagacactgaaacagaacacagggattgcccactttgag
tatcagatccgagtgacctgtgatgaccactactatggctttggctgcaacaagttctgt
cggcccagagatgacttctttggacattatgcctgcgaccagaatggcaacaaaacctgc
atggaaggctggatgggtcctgagtgtaacaaagcaatatgccgacagggctgcagtccc
aagcatggctcctgcaaactcccaggtgactgcaggtgccagtatggttggcagggcctg
tactgtgataagtgcatcccgcacccaggatgtgtccacggcacctgcaatgaaccctgg
cagtgcctctgtgaaaccaactggggtggacagctctgtgacaaagatctgaattactgt
gggactcatcagccctgtctcaaccggggaacatgtagcaacactggccctgacaaatac
cagtgttcctgccccgagggctactcaggaccgaactgtgaaattgctgagcatgcctgc
ctctctgatccctgccacaacagaggcagctgcaaggagacctcctcgggctttgagtgt
gagtgttctccaggctggactggacccacgtgttccacaaacatcgatgactgttctcca
aataactgttcccatggaggcacctgccaggatctagtgaatggattcaagtgcgtgtgc
ccaccccagtggactggcaagacttgtcagttagatgcaaatgagtgcgaggccaagcct
tgtgtaaatgccagatcctgtaagaatctgattgccagctactactgtgattgtcttcct
ggctggatgggtcagaattgtgacataaatatcaatgactgccttggccagtgtcagaat
gatgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgcg
ggcgatcactgtgaaagagacatcgatgaatgtgctagcaacccctgcttgaatgggggt
cactgtcagaatgaaattaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattactgcgagcccaacccttgccagaatggcgcccaatgc
tacaatcgtgccagtgactatttctgcaagtgccctgaggactacgagggcaagaactgc
tcacacctgaaagaccactgccgcaccactccctgtgaagtgattgacagctgcaccgtg
gccatggcctccaacgatactcctgaaggggtgcggtatatctcttccaacgtctgtggt
ccccatgggaagtgcaagagcgagtcaggaggcaaattcacctgtgactgtaacaaaggc
ttcaccggcacctactgccatgaaaatatcaacgactgtgagggcaacccctgtacgaac
ggtggcacgtgcatcgacggcgttaactcctacaagtgtatctgtagtgacggctgggag
ggcgcgcactgtgagaacaacataaatgactgtagccagaacccttgccactatgggggt
acatgtcgagacctggtcaatgacttttactgtgactgcaaaaatgggtggaaagggaaa
acctgccactcgcgtgacagccagtgtgacgaagccacgtgtaataacggtggtacctgc
tatgatgaagtggatacgtttaagtgcatgtgtcctggtggctgggaaggaacaacctgt
aatatagctagaaacagtagctgcctgccgaacccctgtcataatggaggcacctgcgtg
gtcaatggagactccttcacctgtgtctgcaaagaaggctgggaggggccgatttgtact
caaaataccaacgactgcagtcctcacccttgttacaacagcggaacctgtgtggatgga
gataactggtaccggtgcgaatgtgcccctggttttgctgggccagactgcaggataaac
atcaatgagtgtcagtcttccccttgtgcctttggggccacctgtgtggatgagatcaat
ggctaccagtgtatctgccctccaggacatagtggtgccaagtgccatgaagtttcaggg
agatcttgcatcaccatggggagagtgatacttgatggggccaagtgggatgacgactgt
aacacctgccagtgcctgaatggacgggtggcctgctccaaggtctggtgtggcccgaga
ccttgccggctccacaaagggcacggcgagtgtcccaatgggcagagctgcatcccagtc
ctggatgaccagtgtttcgtgcgcccctgcactggtgctggcgagtgtcggtcctccagc
ctccagccagtgaagaccaagtgtacatcggactcttattaccaggacaattgtgcgaac
atcactttcacctttaacaaggagatgatgtctccaggtctcaccactgagcacatttgc
agcgaattgaggaatctgaatattctgaagaatgtttctgctgagtattcaatctacata
gcctgtgagccttccttatcagcaaacaatgaaatacacgtggccatttctgccgaagac
atccgggatgatggaaaccctgtcaaggaaattactgataaaataatagatctcgttagt
aaacgggatgggaacagctcacttatcgctgctgttgcagaagtcagagttcagaggcgc
cctctgaaaaacagaacagatttcctggttcctctgctgagctctgtcttaacagtggct
tgggtctgttgcttggtgacagccttctactggtgtgtgcggaagcggcggcggaagccc
agcagccacacccactctgcccctgaggacaacaccaccaacaatgtgcgcgaacagctg
aaccaaatcaaaaaccccatcgagaaacacggagccaacacagtccccatcaaggattat
gagaacaaaaactccaaaatgtcaaaaatcaggacacacaactcggaagtggaagaggat
gatatggataagcaccagcagaaagtccggtttgccaaacagcccgtgtacacgctggta
gacagagaggagaaggtcccccagcgcacgccgacaaaacacccgaactggacaaacaaa
caggacaacagagacttggaaagtgcccagagcttgaaccggatggagtacatcgtatag

KEGG   Rattus norvegicus (rat): 29147
Entry
29147             CDS       T01003                                 

Gene name
Jag2
Definition
(RefSeq) protein jagged-2
  KO
K21635  jagged-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29147 (Jag2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    29147 (Jag2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29147 (Jag2)
  09162 Cancer: specific types
   05224 Breast cancer
    29147 (Jag2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29147 (Jag2)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA EGF_3
Other DBs
NCBI-GeneID: 29147
NCBI-ProteinID: NP_001362232
RGD: 2938
Ensembl: ENSRNOG00000013927
Position
6
AA seq 1221 aa
MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPTG
PCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIV
EAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSAT
CNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSY
GWQGKFCDECVPYPGCVHGSCVEPWHCDCETNWGGLLCDKDLNYCGSHHPCVNGGTCINA
EPDQYLCACPDGYLGKNCERAEHACASNPCANGGSCHEVLSGFECHCPSGWSGPTCALDI
DECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYY
CDCLPGWKGANCHININDCHGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYYKCASSP
CRRGGICEDLVDGFRCHCPRGLSGPLCEVDVDLCEPNPCLNGARCYNLEDDYYCACPEDF
GGKNCSVPRETCPGGACRVIDGCGFEAGSRAHGAAPSGVCGPHGHCVSLPGGNFSCICDS
GFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSGWEGELCDINPNDCLPDPCHSR
GRCYDLVNDFYCVCDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGST
CTIAKNSSCVPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVD
GVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQEVV
IFTRPCWSRGVSFPHGSSWVEDCNSCRCLDGHRDCSKVWCGWKPCLLSPQPSALSAQCPP
GQQCREKAMGQCLQPPCENWGECTAEDPLPPSTPCLPRTTHLDNNCARLTLHFNRDQVPQ
GTTVGAICSGIRALPATRAAARDRLLLLLCDRASSGASAVEVAVSFSPARDLPDSSLIQS
TAHAIVAAITQRGNSSLLLAVTEVKVETVVMGGSSTGLLVPVLCSVFSVLWLACVVICVW
WTRKRRKERERSRLPRDESANNQWAPLNPIRNPIERPGSSGLGTGGHKDVLYQCKNFTPP
PRRAGEALPGPASHGAGGEDEEDEELSRGDGDSPEAEKFLSHKFTKDPSCSLGRPACWAP
GPKVDNRAVRSTKDVRCAGRE
NT seq 3666 nt   +upstreamnt  +downstreamnt
atgggctatttcgagctgcagctgagcgcgctgcggaacgtgaacggggagctgctgagc
ggcgcctgctgtgacggcgacggccggacgacgcgcgcggggggctgcggccgcgacgag
tgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggccaaggtgacgcccacgggg
ccctgcagctacggctacggcgccacgcccgtgctgggtggcaactccttctacctgccg
ccggcgggcgctgcgggagaccgagcgcgcgcgcggtctcggaccggcggccaccaggac
ccgggcctcgtcgtcattccctttcagttcgcctggccgcgttctttcaccctcatcgtg
gaggcctgggattgggacaatgacaccacaccagatgaggagctgctgattgagcgggtg
tcccatgctggcatgatcaaccctgaggaccgctggaagagcctgcacttcagcggccac
gtggcacacctggagctgcagatccgagtgcgctgtgacgagaactactacagtgccacc
tgcaacaagttctgccggccccggaacgacttcttcggccactacacctgtgaccagtac
ggcaacaaggcctgcatggatggctggatgggcaaggagtgcaaagaagccgtgtgtaaa
caaggatgtaatttgctccacgggggatgcactgtgcctggggagtgcaggtgcagctat
ggctggcagggcaagttctgtgatgaatgtgtcccctaccctggctgcgtgcatggcagc
tgtgtggagccctggcactgtgactgtgagaccaactggggtggcctgctctgtgacaaa
gacctgaactactgtggcagccaccacccctgtgtcaatggaggcacctgtatcaacgcc
gagcctgaccaatacctctgcgcctgcccagatggctacttgggcaagaactgcgaacgg
gctgagcacgcctgcgcctccaacccgtgtgccaacgggggctcttgccacgaagtgctg
tctggctttgaatgccactgtccgtcgggatggagtggacccacctgtgcgcttgacatc
gatgagtgtgcctctaatccgtgtgcggcgggtggcacctgcgtggatcaggtggacggc
ttcgagtgcatctgcccggagcagtgggtgggggctacctgccagctggacgccaatgag
tgtgaagggaaaccgtgccttaatgctttttcttgcaaaaacctgattggcggctattac
tgtgattgcctcccgggctggaagggcgccaactgccacatcaatatcaacgattgccat
gggcagtgtcagcatgggggcacctgcaaggacctggtaaatgggtaccagtgcgtatgc
ccacggggcttcggaggtcgtcactgcgaactagagtactacaagtgtgccagcagcccc
tgccgtcggggtggcatctgtgaggacctggtggatggcttccgctgccactgcccacgg
ggcctctctggtccgctctgtgaggtggacgtggatctctgcgaaccaaacccctgcctc
aacggtgctcgctgctacaaccttgaggatgactactactgcgcctgcccagaagacttt
ggcggcaagaactgctctgtgcccagggagacatgccctggtggggcctgtagagtgatc
gatggctgtgggttcgaggcagggtccagggcgcatggtgctgcgccctccggcgtgtgc
ggtcctcacgggcactgtgtcagcctgcctgggggaaacttctcctgcatctgtgacagc
ggcttcacgggcacctactgccatgagaacatcgacgactgcatgggtcagccctgccgc
aacgggggcacgtgcattgatgaagtggactccttccgctgcttctgccccagtggctgg
gaaggagagctctgtgacatcaatcccaacgactgcctccccgacccctgccacagccgc
ggccgctgctatgacctggtcaatgacttctactgtgtctgcgatgatggctggaagggc
aagacctgccactcacgcgagttccagtgtgacgcctacacctgcagcaacggtggcaca
tgctatgacagcggcgacaccttccgctgcgcgtgccccccaggctggaagggcagcacc
tgcacgatcgccaagaacagcagctgcgtgcccaatccctgtgtgaatggaggcacctgt
gtgggcagtggagactctttctcctgcatctgccgggatggctgggagggccgcacctgc
acacacaacaccaatgactgcaaccctctgccctgctacaacggaggcatctgtgtggat
ggcgtcaactggttccgctgcgagtgtgcacctggctttgcgggtcctgactgccgtatc
aacatcgatgagtgccagtcctcaccctgtgcctacggagccacgtgtgtagatgagatc
aatgggtaccgctgcagctgcccaccaggacgttccggccccagatgccaggaagtggtc
atattcacgaggccctgctggtcccggggcgtgtccttcccacatgggagttcctgggta
gaagactgcaacagctgccgctgcctggatggccaccgggactgcagcaaggtgtggtgt
ggttggaagccttgtctgctgtcccctcagcccagtgctctgagtgcccagtgcccacca
gggcagcagtgccgggagaaggccatgggtcagtgtctgcagcccccctgtgagaactgg
ggggagtgtacagcagaggatcctctgccccccagcaccccctgtctgccacggaccact
catttggacaacaactgtgctcgcctcacactgcactttaaccgtgaccaagtgcctcag
ggcaccaccgtgggcgccatctgctctggaatccgagccctgcccgccacgagggcggcg
gcacgagaccgcctcctcctgctgctctgtgaccgcgcatcctcaggggccagtgccgtg
gaggtggctgtgtctttcagccctgcaagggacctgcccgacagcagcctgatccagagc
acagcccatgccatcgtggctgccatcacccagagaggaaacagctcactgctgctggct
gtcaccgaggtcaaggtggaaacagttgttatgggtggctcttccacaggtctgttggta
cctgtgctgtgtagcgtgttcagtgtgctgtggcttgcctgtgtggttatctgcgtgtgg
tggacacggaagcgcaggaaagaacgtgagaggagccggctaccacgggacgagagcgcc
aacaaccagtgggctccgctcaatcccatccgcaaccccattgagcggccaggcagcagt
ggtctgggaaccgggggccacaaggacgtactctaccagtgcaagaacttcacaccgccg
ccccgcagggcaggcgaggcactgcctgggccggccagccacggggctggtggggaggac
gaggaggatgaggagctgagccgaggagatggggactctccagaagcagagaagttcctc
tcacacaaattcaccaaagaccccagctgctccctgggaaggccagcctgctgggctccg
gggcccaaagtggacaaccgcgccgtcagaagcaccaaggatgtgcgctgtgctggcagg
gagtag

DBGET integrated database retrieval system