KEGG   Rattus norvegicus (rat): 29220
Entry
29220             CDS       T01003                                 

Gene name
Thbs4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05144  Malaria
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    29220 (Thbs4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    29220 (Thbs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29220 (Thbs4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29220 (Thbs4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29220 (Thbs4)
  09174 Infectious disease: parasitic
   05144 Malaria
    29220 (Thbs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29220 (Thbs4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29220 (Thbs4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29220 (Thbs4)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    29220 (Thbs4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    29220 (Thbs4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29220 (Thbs4)
  Exosomal proteins of colorectal cancer cells
   29220 (Thbs4)
  Exosomal proteins of bladder cancer cells
   29220 (Thbs4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   29220 (Thbs4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   29220 (Thbs4)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 EGF cEGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 29220
NCBI-ProteinID: NP_058829
RGD: 62046
Ensembl: ENSRNOG00000012471
UniProt: A0A0G2K7L8
Position
2q12
AA seq 961 aa
MLAPRAAAFLLLHLVLQPWQRAGAQATPQVFDLLPSSSQRLNPAALQPVLTDPTLHELYV
ISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKDDGKIHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGSVELYLDCVQVDSVNNLPRAFSGLTQNPQAIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAPPAPPTRPTRRCDSSPCFRGVR
CTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPGVRCTNLAPGFRCDACPVGFTGP
MVQGVGINFAKTNKQVCTDVDECRNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGCRT
ERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNVDQRNTDKDIFG
DACDNCRGVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPRVPNRDQQDRDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNNDGVGDICEADFDQDKVIDRIDVCP
ENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQIQTFDRLD
N
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgctagccccacgcgcggccgccttcctcctactgcacctggtcctgcagccgtggcag
cgggcgggcgcccaggccacaccccaggtctttgaccttctgccatcctccagccagagg
ctgaacccggccgccctgcagccagtcctgacagaccccaccctgcacgagctctatgtc
atctccaccttcaagctgcagagtaagagctcagccaccatctttggcctctactcctcg
agtgacaacagcaaatactttgaattcactgtgatgggacgcctgaacaaagccatcctc
cgttacctaaaggatgatgggaagattcatctggtggttttcaacaacctgcagctggcg
gatgggaggcgccaccggattctcctgagactcagcaatttgcagagaggggccggctcc
gtagaactctacttggactgtgtccaggttgattcagtgaacaacctccccagagccttc
tctggtctcacccagaacccacaggccattgaattgagaacattccagaggaagccccag
gacttcttggaagagctgaagctggtggtgaggggctctctgttccaggtggccagccta
caagactgtttcctgcagcagagtgagccgctggctgccacaggcacaggagactttaat
cgacagtttttgggtcaaatgacacaattaaaccagctccttggagaggtgaaagatctt
ctgaggcagcaggtcaaggaaacatcatttttgcgaaacactattgctgagtgccaggct
tgtggccctctcagcttccagtccccaaccccaaacacgctggtgcccatagctcctcca
gcacccccaacccgaccaacacgtcgctgtgactccagcccttgtttccgaggtgtccga
tgcacggacaccagggacggcttccaatgtggaccctgcccagatggctacacggggaac
gggatcacctgttctgacgtggatgagtgtaaataccatccctgctaccctggtgtgcgc
tgcacaaatttggctccgggtttcagatgtgatgcctgtccagtaggcttcacggggccc
atggtgcagggcgtggggatcaactttgccaaaacaaacaagcaggtgtgcactgatgtt
gacgagtgtcggaacggagcgtgtgttctgaactccatctgcattaacactctgggctct
taccgctgtgggccttgcaagccagggtacactggtgaccagacgaggggatgcaggacc
gaaaggagctgccggaacccagagcagaacccgtgcagtgtgcatgcgcagtgcattgag
gaacggcaaggggatgtgacgtgtgtgtgcggtgttggttgggccggcgacggctatgtc
tgtggaaaggatgtggacatcgacagttaccccgatgaagaactgccgtgctcagccagg
aactgcaagaaggataactgcaagtatgtgccaaactccggccaagaagacgcagacaga
gatggcattggagacgcctgtgatgaggatgcggatggagacgggatcttgaatgagcag
gacaactgtgtcctgactcacaatgtggaccagaggaacactgataaagatatctttggg
gatgcctgtgacaactgccggggcgtcctgaataatgaccagaaggacactgacggggat
gggaaaggagacgcctgtgatgacgacatggatggagacggaataaaaaacattttggac
aactgtccccgagttcccaaccgcgaccaacaggatcgggatggcgatggtgtcggagac
gcctgtgacagctgtcctgatgtcagtaaccctaaccagtcggatgtggataacgatctg
gttggggactcctgtgacaccaaccaagacagtgatggggatggccaccaggacagcaca
gacaactgccccaccgtcattaacagcgcccagctggacaccgacaaggacgggattggc
gatgaatgcgatgacgatgacgataatgacggcatcccagacctggttccccctggccca
gacaactgcaggcttgttcccaacccagcccaggaagatagcaacaatgatggagtagga
gatatctgtgaagctgacttcgaccaggacaaggtcattgatcgcattgatgtgtgtcct
gagaatgcggagatcaccctgactgacttcagggcctatcagactgtggtcctggaccct
gaaggggatgcccagatcgaccccaactgggtggtcctgaaccagggcatggagattgtg
cagaccatgaacagtgaccctggcctagcagtcgggtacacggcatttaatggagttgac
tttgaagggaccttccacgtaaacacccagacagatgacgactatgccggctttattttt
ggttaccaagacagttccagcttctatgtggtcatgtggaaacagacagagcagacatac
tggcaggctacgccattccgtgcagtagcagaacctggtattcagctcaaggccgtgaag
tctaaaactggcccaggggaacatctccgaaactccctgtggcacacaggggacaccagc
gaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaaggtgtcc
taccgctggttcctgcagcataggccccaggtgggctacatcagggtgcggttttatgaa
ggctcagagttggtggctgactccggggtcactatagacaccaccatgcgcggaggccga
ctgggcgtgttctgcttctctcaggaaaacatcatctggtccaacctcaagtaccgctgt
aacgacaccataccagaggacttccaggagttccagatccagacctttgaccgcctggat
aattaa

DBGET integrated database retrieval system