KEGG   Rattus norvegicus (rat): 29243
Entry
29243             CDS       T01003                                 

Gene name
F10
Definition
(RefSeq) coagulation factor X
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    29243 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29243 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29243 (F10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     29243 (F10)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   29243 (F10)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   29243 (F10)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF hEGF Trypsin_2 DUF1986 EGF_3 cEGF EGF_CA
Other DBs
NCBI-GeneID: 29243
NCBI-ProteinID: NP_058839
RGD: 61850
Ensembl: ENSRNOG00000033444
UniProt: Q63207
Position
16q12.5
AA seq 482 aa
MESPVRLSLLYVVLASLLLPGRSVFINRERANNVLQRIRRANSFFEEIKKGNLERECVEE
ICSFEEAREVFEDNEKTTEFWNKYEDGDQCESSPCQNQGECRDGLGSYTCTCTEGFEGKN
CELFVRKLCSLDNGDCDQFCREEQNSVVCSCAKGYFLGNDGKSCLSTAPFPCGKTNKGRA
KRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKR
GECPWQALLFSDEETDGFCGGTILNEFYILTAAHCLHQAKRFKVRVGDLNTEQEDGGEMV
HEVDMIIKHNKFQRDTYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVS
GFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAGYDAKQEDACQGDSGGP
HVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKARVGPTSETPRLTHP
PY
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggagagcccggtgcgactcagccttctctatgttgtcctggccagcctcctgctcccg
gggagaagtgtgtttattaaccgggaacgagccaacaacgtcctgcagaggattcggaga
gcaaactcattttttgaggagataaagaaaggaaatctggaaagggagtgtgtggaagaa
atttgttcttttgaagaggcccgcgaagtctttgaggacaatgagaagacgacagaattc
tggaacaaatatgaagatggtgaccagtgtgagagcagtccttgccagaaccaaggcgag
tgtcgagatggccttgggagttatacatgcacctgcacggagggattcgaaggcaaaaac
tgtgaactctttgttcggaaactctgcagcctagacaacggagactgcgaccagttctgc
cgtgaggagcagaactcagtggtgtgctcctgtgccaagggttacttcctgggtaatgac
ggcaagtcctgcctctccacagctcccttcccctgtggaaaaaccaataaaggacgcgcg
aagaggtctgtggccctaaataccagcaacagtgaacctgaccctgaagacctcatgcct
gatgcagatattctatatcctactgagagtccttctgaactgctcaatctcaacaagaca
gagcctgaagcaaacagtgatgacgttattcggattgtgggtggccaagaatgcaagaga
ggagaatgtccttggcaggctctgctctttagcgacgaagagactgatgggttctgtggg
ggcaccatcttgaatgagttctacatcctcactgccgcccattgtctccatcaagccaag
cgattcaaggtgagggtaggggacctgaacacggaacaggaagacggcggcgagatggtg
cacgaggtggatatgatcatcaagcacaacaagtttcagagggacacctacgacttcgac
attgccatgctgaggctgaagacccccatcacgttccgcgagaacgtggcccctgcctgc
ttgcctcagaaagactgggccgaggccacactgatgacgcaaaagacaggcatcgtgagc
gggtttggacgcacgcacgagaagggccgccagtccaaagtcctgaagatgatggaggtg
ccctatgtggaccgcaacacctgcaggctctccaccagcttcagcattacgcagaatatg
ttctgcgcaggctatgacgccaagcaagaggacgcctgccagggggacagcggtggccct
cacgtcacacgattcaaagacacctactttgtgaccggcatcgtcagctggggagagggg
tgtgcaaggaaagggaaatacggcatctacacgaaggtcacggccttcctcaaatggatt
gacaggtccatgaaagccagggtggggcccacctctgagaccccaaggttaacccatcca
ccctattaa

DBGET integrated database retrieval system