KEGG   Rattus norvegicus (rat): 293692
Entry
293692            CDS       T01003                                 
Symbol
Ehd1
Name
(RefSeq) EH domain-containing protein 1
  KO
K12483  EH domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    293692 (Ehd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293692 (Ehd1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    293692 (Ehd1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    293692 (Ehd1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   293692 (Ehd1)
SSDB
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU Roc Gtr1_RagA AAA_28 TsaE AIG1 AAA_16 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 293692
NCBI-ProteinID: NP_001011939
RGD: 1309017
Ensembl: ENSRNOG00000043503
UniProt: Q641Z6
Position
1:203579850..203602226
AA seq 534 aa
MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRR
PFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSL
GKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQ
ELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQAVKGGAFDGTMNG
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTV
LGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKRRHE
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgttcagctgggtgagcaaggatgcccgccgcaagaaggagccggagctcttccagacg
gtggccgaggggctgcggcagctgtacgcgcagaagctgctgccgctggaggagcactat
cgcttccacgagttccattcgccggctctggaggacgctgacttcgacaacaaacccatg
gtgctcctggtcggccagtacagcaccggcaagaccaccttcatccgccacttgatcgag
caggacttcccagggatgcgcatcgggccggagcccaccaccgactccttcatcgcagtc
atgcatggccccaccgagggcgtggtgcccggcaacgcgctcgtcgtggacccgcggcgc
cccttccgcaagcttaacgccttcggcaacgccttcctcaacaggttcatgtgtgcacag
ctgcctaacccagtattggacagcattagcatcattgacactcctggaatcctgtctgga
gagaagcagcgcatcagccgaggttatgactttgcggctgtccttgagtggttcgcagag
cgtgtggaccgcatcattctgctctttgacgcccacaagctagacatctcagatgaattt
tcagaagtcatcaaggccctcaaaaatcacgaggacaagatccgtgtggtgctgaacaaa
gctgaccaaattgagacacagcagctgatgcgagtgtacggagctctcatgtggtcgctg
gggaagatcatcaacacccctgaggtggtccgtgtctacattggctccttctggtcacac
ccactgctcatccctgacaaccggaagctctttgaggcagaggagcaggacctcttcaaa
gacatccagtctctaccaagaaatgctgcccttaggaagctcaatgacttaatcaagcgg
gccaggctggccaaggtccatgcctacatcatcagctccctcaagaaggagatgcccaat
gtctttgggaaagagagcaagaagaaagagctggtgaacaacttgggagagatctaccag
aaaattgagcgggagcaccagatctcctccggcgacttcccaagcctgcgtaagatgcag
gaacttctgcagacgcaggacttcagcaagttccaggccttgaagcccaagctgctggat
acggtggatgatatgctggccaacgatatagctcggctgatggtgatggtgcgccaggag
gagtccctgatgccctcacaggctgtgaagggtggtgcttttgatggcaccatgaatggg
ccctttgggcatgggtatggcgagggggctggcgagggcattgatgatgttgagtgggta
gttggcaaggacaagcccacctatgatgagatcttctacacactgtctcctgtcaatggc
aagatcacgggcgctaatgccaagaaggagatggtgaagtccaagctgcctaacacagtg
ctggggaagatctggaagctggctgatgtggacaaggatggcctgctagatgacgaggag
tttgccctggccaaccaccttatcaaggtcaagctagagggccatgagctgcccgctgac
cttcctccacatctcatcccaccctccaaacggaggcatgagtga

DBGET integrated database retrieval system