KEGG   Rattus norvegicus (rat): 294260
Entry
294260            CDS       T01003                                 

Gene name
Skiv2l
Definition
(RefSeq) Ski2 like RNA helicase
  KO
K12599  antiviral helicase SKI2 [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    294260 (Skiv2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    294260 (Skiv2l)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     294260 (Skiv2l)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     294260 (Skiv2l)
  mRNA degradation factors
   3'-5' decay
    Ski complex
     294260 (Skiv2l)
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT Ski2_N DEAD Helicase_C ResIII HAS-barrel DUF3516
Other DBs
NCBI-GeneID: 294260
NCBI-ProteinID: NP_998724
RGD: 1303059
Ensembl: ENSRNOG00000000421
Vega: OTTRNOG00000001713
UniProt: Q6MG76
Position
20p12
AA seq 1241 aa
MMETERLVLPPPDPLNLPLRALEVGCTGRWELLNVPGPPESTLPHGLPPCAPDLCQEAEQ
LFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAALGTPVPSDLQAQRHPTTGHILGYKEVL
LENTNLSATTSLSLRRPPGPASQSLWGNPTQYPFWPGGMDEPSITDLSTREEAEEEIDFE
KDLLTVPPGFKKGVDFAPKAPVPGLLSLSRLLEPLDLSGGDEGEGEAAGGPRGDAASASP
SSTPLIRASSLEDLVLKEASTVVSTLEPLKPPPQEQWAVPVDVTSPVGDFYRLIPQPAFQ
WAFEPDVFQKQAILHLEQHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALS
NQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVH
YINDAERGVVWEEVLIMLPEHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVARPVP
LEHYLFTGNSPKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGG
PAQDRGVYLALLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQR
CLARLRGSDRQLPQVLHMSELLRRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFA
MGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEM
ADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQAL
ADLTKRLGALEEPDVTGQLADLPEYYSWAEELTETRNMIQRRIMESVNGLKSLSVGRVVV
VKNEEHHNALGVILQVSSNSTSRVFTTLVLCDKPAVSENPRDKGPATPDVPHPDDLVGFK
LFLPEGPCEHTVAKLQPGDVAAISTKVLRVNGEKISEDFSKRQQPKFRKDPPLAAVTTAV
QELLRLAQAYPAGPPTLDPINDLQLKDVAVVEGGLRARKLEELIRGAQCVHSPRFPAQYV
KLQERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMS
SHELLLTELMFDNALSALRPEEIAALLSGLVCQSPGDPGDQLPSTLKQGVERVKAVAKRI
GEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAE
MCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ
NT seq 3726 nt   +upstreamnt  +downstreamnt
atgatggagaccgagcgactcgtgctgcctcccccagaccccctgaacctgccccttcga
gctctggaagtggggtgcactggccgttgggagctgctaaacgtgccagggcctccagag
agtactcttccccatggcctccctccctgtgccccagatctgtgccaggaagcagagcag
ttgtttctgtcgtctccggcctggcttcctctacacggtgtggagcactcagctcgaaaa
tggcagaggaagacagatccctggtcgcttctggctgctctggggactccagtcccatcc
gaccttcaggcccagagacacccaaccacaggccatatactgggctataaggaggtcctg
ctggagaacacgaacctgtcggccaccacctccttgtcccttcgccggcctccagggcca
gcctcccagtcgctatggggcaatccgacacagtaccctttctggccgggtgggatggac
gagcccagcataactgatctgagtactcgggaggaagccgaggaggagatagactttgag
aaagatcttctcaccgttccacccggcttcaagaaaggggtggattttgcccccaaagct
cctgtgccaggtttgctcagcctcagccgtctgctggagcctctggatctgagtggaggt
gatgagggtgagggagaggcagcaggaggtcctagaggggatgcggcctcagcctctccc
tccagcactcccctgatccgggcaagcagcttggaggacctagtgttgaaggaagcttcc
acagtcgtatccaccctggagcccctcaaacctccacctcaggaacagtgggctgtgcct
gtggacgtcacctcccccgtgggtgatttttaccgtctcatccctcagccggccttccag
tgggcgttcgagccagatgtgtttcagaagcaggccatcctgcacttggagcagcacgac
tctgtctttgttgcagctcacacatccgctgggaagacggtggtggccgagtatgccatt
gccctggcccagaaacacatgacccgtaccatctacacttctcctatcaaagccctgagc
aaccagaagtttcgggacttccgaaacacattcggggatgtgggactgctcacgggggat
gtgcagctgcacccagaggcctcctgcctcatcatgaccacggagatccttcgctccatg
ctgtacagtggctcagacgtcatccgagacctggagtgggtcatttttgatgaagtccac
tatatcaatgatgctgagcgtggggtcgtgtgggaggaggtgctcattatgctccctgag
cacgtctccatcatcctgctgagtgccaccgtccccaacgccctggagtttgctgactgg
atcgggaggctgaagcggcggcagatctatgtgatcagcacggtggcccgtcccgtcccc
ttggagcactatctcttcacaggaaacagccccaagacacagggcgaactcttccttctg
ctggactcccgaggggccttccacaccaaggggtactacgctgccgtggaggccaagaaa
gagaggatgagcaaacacgcccagaccttcggggccaagcagcccacacaccagggtggg
cctgcgcaggaccgtggggtgtacctggccttgctggcttccctccggacccgggctcag
ttgcctgtggtagtgttcaccttctcccgaggccgctgtgatgaacaggcttcaggtctc
acctccctagacctcacaacaagctcagagaagagtgagatccacctcttcctgcagcgc
tgtcttgcccggctccgaggctctgaccgacagctcccccaggtcctgcacatgtcggag
ctcctccgccgaggcctgggtgtgcaccacagcggcatcctgcccatccttaaggagatt
gtggagatgcttttcagccggggcctagtcaaggtcctgtttgccaccgagacttttgcc
atgggggtaaacatgccagccaggacagtggtgtttgactccatgcgcaaacatgatggc
tccaccttccgggacctgctgcctggagagtacgtgcagatggcaggccgggcgggccgg
aggggcctggaccccacgggcaccgtcatccttctctgtaagggccgagtgcctgagatg
gcagatctacaccgcatgatgatggggaaaccatcacagcttcagtcccagttccgcctc
acatataccatgatcctcaacctgctgcgggtggacgccctcagagtggaagacatgatg
aagaggagcttctcagagttcccctcccgcaaggacagcaaggcccatgagcaggctctg
gctgacctcaccaagaggctgggggctttggaggagcctgatgtgactggtcagttggct
gacctgcctgagtattacagctgggcggaggagctgacagagacccggaacatgatccag
cgacgcatcatggagtctgtgaacgggctgaaatctctgtcagtgggaagggtggtggtt
gtgaagaatgaagagcatcacaatgcgctgggtgtgatcctgcaggtctcctcaaactcc
actagccgagtatttacaaccttggtcttgtgtgataaacctgctgtgtctgagaaccca
agggacaaggggccagccactccagatgtgccccacccagatgaccttgtaggcttcaag
ttgttcctgcctgaagggccctgcgagcacactgtggccaagctccagccaggggatgtg
gctgccatctctaccaaggtgctccgggtgaatggggagaagatttctgaggacttcagc
aagaggcagcaaccgaaattcaggaaggaccctcccctcgcggccgtgaccactgctgtt
caggagctgctgcgtctggcccaggcctatccagcaggacccccaaccctcgaccctatc
aacgacctgcaactgaaggatgtggcagtggtagaaggtgggctccgggcccggaagctg
gaggagctgatccgaggcgctcagtgtgtacacagcccccggtttcctgcccagtatgtg
aagctacaggagcgaatgcagattcagaaggaaatggagaggctgcgcttcctcctgtct
gaccagtcgctgttgctgctccccgagtaccaccagcgtgtagaggtgcttcggaccctg
ggctatgtggatgaggctggcacagtgaagctggcgggccgggtggcctgtgccatgagc
agccatgagctgctcctcactgaactcatgtttgacaatgcactgagtgctctgcgacca
gaggaaatagcagctctgctctctggtctggtgtgccagagccccggagaccctggggat
cagctgccaagcaccctcaaacagggggtagaacgcgtcaaagctgtggccaagcggatt
ggtgaggttcaggtggcctgcggcctgaaccagacggtggaggaatttgtgggggagctg
aattttgggctggtggaagttgtttatgagtgggctcggggtatgcccttctccgagttg
gcagggctctcggggacccccgaaggcttggttgtccgctgtatccagcgcctggctgag
atgtgccgctcacttcgaggggcggcccgtttggtaggagagcctgtgttaggggccaag
atggagacggcagccaccttgctccggagggacatcgtcttcgcagccagcctctatacc
cagtaa

DBGET integrated database retrieval system