KEGG   Rattus norvegicus (rat): 29492
Entry
29492             CDS       T01003                                 

Gene name
Notch2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29492 (Notch2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    29492 (Notch2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29492 (Notch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29492 (Notch2)
   05206 MicroRNAs in cancer
    29492 (Notch2)
  09162 Cancer: specific types
   05224 Breast cancer
    29492 (Notch2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29492 (Notch2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29492 (Notch2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 EGF_2 Notch Ank_2 NOD Ank Ank_5 NODP Ank_3 Ank_4 cEGF
Other DBs
NCBI-GeneID: 29492
NCBI-ProteinID: NP_077334
RGD: 3188
Ensembl: ENSRNOG00000018835
UniProt: G3V8G9
Position
2q34
AA seq 2471 aa
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGYCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVTQAMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSWDTYECTCQVGFTGKQCQWTDVCLSHPCENGSTCSSVANQFSCRCPAGITGQKCD
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTSECHCLPGFEGSNCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGTLCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCLHGACV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPHHPSCYSQ
VNECLSSPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCLDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFTCLCAPGWQGQRCTVDVDECVSKPCMNNGICHNTQGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDKVNTFSCLCLPGFVGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNSGTCVDGLGTYRCTCPLGYTGKNCQTLVNLCSPSPCKNKGTCAQ
EKARPRCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLKNNYQCVCRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNVPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPHCFCLNRKDCESGCAS
NPCQHGGTCYPQRQPPYYSCRCSPPFWGSHCESYTAPTSTPPATCLSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSSLRCWEYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDKGCNNEECGWDGLDCAADQPENLAEGILVIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYYGEKSAAMKKQKVARRSLPDEQEQEIIG
SKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESEDPRNTPLLY
LLAVAVVIILFLILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSTTSEHWGDDEGPQPKKAKAEDDEALLSEDDPVDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPMG
KKARRPNTKSTMPTSLPNLAKEAKDVKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTY
VSDATSSPMITSPGILQASPTPLLAAAPAAPVHAQHALSFSNLHEMQPLAPGASTVLPSV
SQLLSHHHIVPPGSGSAGSLGRLHSVPVPSDWMNRVEMSETQYSEMFGMVLAPAEGTHPG
MAAPQSRAPEGKPIPTQREPLPPIVTFQLIPKGSLAQAAGAPQTQSGCPPAVAGPLPSMY
QIPEMARLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAER
TPNHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMS
EPPHSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcccgctctgcgtcccgccgcgctgcgggcgctgctgtggctctggctgtgcggcgcg
ggccccgcgcacgctttgcagtgtcgaggtggtcaagagccctgtgtaaatgaggggacc
tgtgttacctaccacaacggcacaggctactgccgatgtccagagggcttcttgggagaa
tattgtcaacatcgagacccttgtgagaagaaccgctgtcagaatggtggtacttgtgtg
acgcaggccatgttgggaaaagccacctgtcgatgtgctccagggttcacaggggaggac
tgccaatactcgacctctcacccctgttttgtttcccgcccctgtcagaatggaggtacc
tgccacatgctcagctgggacacctatgagtgcacctgtcaagttggcttcacaggaaag
cagtgtcagtggacagatgtctgtctgtctcatccctgtgaaaatggaagcacctgtagc
tctgtggccaaccagttctcctgcagatgtcctgcaggcatcacaggccagaagtgtgac
gccgacatcaatgaatgtgacattccaggacgctgccaacatggaggcacctgcctcaac
cttcctgggtcctaccgatgccaatgccctcagggcttcacaggccagcactgtgacagc
ccgtacgtgccctgtgcaccctcaccctgcgtcaatggaggcacctgccgtcagactgga
gacttcacttctgaatgccattgcctgccaggctttgaagggagcaactgcgagcggaat
atcgacgactgccctaaccacaagtgtcagaatggaggggtgtgtgtggatggcgtcaat
acttacaactgccgctgcccccctcagtggactgggcagttctgcacagaagacgtggat
gagtgtctgctgcagcccaatgcttgtcagaatggaggcacttgcaccaaccgcaacgga
ggctacggctgcgtgtgcgtgaacggctggagtggggatgactgcagcgagaacatcgat
gactgtgccttcgcttcctgcacgccaggctccacctgtattgaccgtgtggcctccttc
tcctgcctttgtccagagggaaaggcagggctcctgtgtcatctggatgatgcctgtatc
agcaacccttgtcacaagggggcgctgtgtgataccaaccccctgaatgggcagtacatt
tgcacctgcccacagggctacaagggcgctgactgcacagaagacgtggatgagtgtgct
atggccaacagtaacccttgtgagcatgcaggaaagtgtgtgaatacagatggcgccttc
cactgcgagtgtctgaagggctacgcagggcctcgctgtgagatggacatcaacgagtgt
cactcagacccctgtcagaacgacgccacctgcctggataagattggaggcttcacctgt
ctctgcatgccgggtttcaaaggtgtgcattgtgaactggaggtgaatgaatgccagagc
aacccgtgtgtaaacaatgggcagtgtgtggacaaagtcaatcgcttccagtgtctgtgt
ccccctggtttcacaggaccagtgtgccagatcgacattgacgactgctccagtactccc
tgcctgaatggggccaagtgcatcgatcacccgaatggctatgaatgccagtgtgccaca
ggattcactggcacactgtgtgatgagaacatcgacaactgtgacccggatccttgccac
catggccagtgccaggatgggattgactcctacacctgcatctgcaaccccgggtacatg
ggagccatctgtagtgaccagattgatgaatgctacagcagcccctgcctgaatgatgga
cgctgcatcgacctggtgaacggctaccagtgcaactgccaaccgggtacctcaggcctt
aattgtgaaattaattttgatgactgtgccagcaacccttgtctgcacggagcctgtgtg
gacggcatcaaccgttacagttgtgtgtgctctccgggattcacagggcagaggtgcaac
atagacattgatgagtgtgcctccaacccctgtcgcaagggtgcgacgtgcatcaatgac
gtgaatggtttccggtgtatgtgccctgagggaccacaccatcccagctgctactcacag
gtgaacgagtgtttgagcagtccctgcatccatggaaactgtactggaggtctcagtggc
tataagtgcctctgcgatgcaggctgggttggtatcaactgcgaagtggacaaaaatgag
tgtctttctaacccgtgccagaatggagggacatgtaataacctggtgaatggctacagg
tgtacatgcaagaaggggttcaaaggctataactgccaggtgaacatagatgagtgtgcc
tcgaacccgtgtctgaaccaagggacctgcctcgatgacgtcagtggctacacctgccac
tgcatgctgccttacacaggcaagaattgtcaaacggtgttggcgccctgctcccctaac
ccgtgtgagaacgctgcagtttgtaaagaggcacccaactttgagagcttcacctgcctg
tgtgcccctggctggcaaggtcagcgctgtacagttgacgttgatgagtgtgtctccaag
ccgtgtatgaacaatggcatctgccataatactcagggcagctacatgtgcgagtgccct
cccggcttcagtggtatggactgtgaggaggacatcaatgactgccttgccaacccctgc
cagaacggaggctcctgtgtggacaaagtgaacaccttctcctgcctgtgccttcctggc
ttcgtaggggacaagtgccaaacagacatgaatgaatgtctgagcgagccctgtaagaat
ggggggacctgctctgactacgtcaacagctacacctgcacgtgccctgcgggcttccat
ggagtccactgtgaaaacaacatcgatgagtgcactgagagctcctgtttcaatggcggc
acgtgtgttgatgggatcaactctttctcttgcttatgccctgtgggtttcactggtccc
ttctgcctccatgatatcaatgagtgcagctctaacccgtgcctgaattcgggaacgtgt
gttgatggcctgggtacctaccgatgcacctgtcccttgggctacactgggaaaaactgt
cagaccctggtgaacctctgcagcccctctccatgtaaaaacaaaggaacttgtgctcag
gaaaaggcaaggccacgctgcctgtgtccgcctggatgggatggcgcatactgtgatgtg
ctcaatgtgtcctgtaaggcggcagccttgcagaaaggagtacctgttgaacacttgtgc
cagcactcgggtatctgtatcaatgctggcaacacgcatcactgccagtgccccctgggc
tacacggggagctactgcgaggaacagcttgacgagtgtgcgtccaatccatgccagcat
ggtgccacctgcagtgacttcatcggaggatacagatgtgagtgtgttccagggtatcag
ggtgtcaactgtgagtatgaagtggacgagtgccagaaccagccctgtcagaacggaggc
acctgcatcgacctcgtgaaccatttcaagtgctcgtgcccaccaggcacccggggcctg
ctttgtgaagagaacattgatgactgtgctgggggcccccactgccttaatggtggccag
tgtgtggaccggattggaggctacagttgtcgctgtttgcctggctttgctggggagcgg
tgtgagggggacatcaatgaatgcctgtccaatccttgcagctcagagggcagcctggac
tgcattcagctcaaaaataactaccagtgtgtctgccgcagcgccttcacaggccgacac
tgcgaaaccttcctagatgtgtgtccccagaagccttgcctgaatggagggacttgtgct
gtggctagcaacgtgcctgatggcttcatttgtcgttgtcccccagggttctccggggca
agatgccagagcagctgtggacaagtgaagtgcagaagaggggagcagtgtgtgcacacc
gcctcgggaccccactgcttctgcctgaaccgcaaggactgcgagtcaggttgcgctagt
aacccctgccagcacggaggcacctgctaccctcagcgccagcctccttactactcttgc
cgctgctccccaccgttctggggcagccactgcgagagctacacagcccccaccagcacc
cctcctgctacctgtctgagtcagtactgtgccgacaaggctcgggacggcatctgtgat
gaggcctgcaacagtcatgcctgccagtgggatggaggtgactgttccctcactatggag
gacccctgggccaactgcacctcctcacttcgctgctgggagtacatcaacaaccagtgt
gatgagctgtgcaacactgcagagtgcctgtttgacaactttgaatgccagaggaatagc
aaaacctgcaagtatgacaaatactgtgcagaccacttcaaagacaatcactgcgataag
ggatgcaacaacgaggagtgtggctgggacgggctggactgcgctgcggaccagcctgag
aacctggcggagggcatcctggtcatcgtggtgctcctaccccctgagcagctgcttcag
gattctcgaagcttcttgagggccctgggcaccctgctccacaccaacttacgcattaaa
caagactctcagggcgccctcatggtgtacccctactatggggagaagtcagctgccatg
aagaagcagaaggtggcacgcaggtctcttcctgatgagcaggaacaggagataataggc
tctaaggtatttctggaaatcgacaaccgacagtgtgttcaagactcagaccagtgcttc
aagaacacagatgctgcagctgctctcctggcttctcatgccatccaagggaccttgtcc
taccctctggtgtctgttgtcagtgaatcggaggatccaaggaacactccgctcctctat
ctgcttgcggttgctgtggtcattatcctgttcctcatcctgctgggggtcatcatggca
aagcggaagcgcaagcacggcttcctctggctgcctgaaggcttcacgcttcgccgagac
tccagcaatcacaagcgccgtgaacctgtggggcaggatgccgtggggctgaagaatctc
tcagtgcaagtgtcagaggcaaacctgatcggctccacgacaagcgagcattggggtgat
gatgaaggaccccagccaaagaaagccaaggctgaggacgacgaggctttgctgtcggaa
gacgaccctgtcgaccggcgcccctggacacagcagcaccttgaagctgcagacatccgc
cggactccatccctggcgctcacccctcctcaggcagagcaggaggtggacgtgctggac
gtgaatgtccgaggcccagatgggtgcaccccactgatgctggcttctctccgaggaggc
agctcagacctgagtgatgaagatgaagatgctgaggactcttctgccaacatcatcaca
gacttggtctaccaaggtgccagcctccaggcacagacggaccgcactggtgagatggcc
ctgcaccttgcagcccgctattcgagagctgatgctgccaaacgcctcctggatgctggt
gcagatgccaacgcccaggacaacatgggccgctgtcctcttcatgctgcagttgcagcg
gatgcccaaggtgtcttccagattctgatccgcaaccgagtaacggatctagacgccagg
atgaatgatggcactacccccctgatcctggctgcccgcctggctgtggaaggaatggtg
gcagagctgatcaactgccaagcagatgtgaacgcagtggatgaccatggaaaatctgcc
ctccactgggcagccgccgtcaataatgtggaggcaactcttttgctgttgaagaatggg
gccaaccgggatatgcaggacaacaaggaagagacacctttgtttcttgctgcccgagag
ggaagttatgaagcagccaaaatcctgttagaccactttgccaaccgggacatcacggac
cacatggaccgccttccccgggatgtggctcgggaccgcatgcaccatgacatagttcgc
ctcctggacgagtacaacgtgactcccagccctccggggactgtcttgacttctgctctc
tcacctgtcctctgtgggcccaacaggtctttcctcagtctgaagcacaccccaatgggt
aagaaggccagacggcccaacaccaagagcaccatgcccacaagcctgcctaaccttgcc
aaggaggccaaggacgtcaaggggagcaggaggaagaagtgtctcaacgagaaggtccag
ctctccgagagctcagtgactttatcccctgtcgactcgctcgagtctcctcacacatat
gtttctgatgccacgtcttcccccatgatcacgtcccctgggatcttacaggcctcaccc
acgcctcttctggctgctgccccagctgccccagtgcatgctcagcatgcactgtctttc
tctaaccttcacgaaatgcagcctttggctcctggagccagcaccgtgctcccctcagtt
agccagttgttgtcccaccaccacatcgtccccccagggagtggcagtgcaggaagcttg
ggcaggttacattcagtccctgtcccctcagactggatgaaccgcgtggagatgagtgag
acccagtacagtgaaatgtttggcatggtcctggctcctgcagagggaacccaccctggc
atggcagctcctcagagcagagctccggaagggaagcccatccccacacagcgtgagccc
ttgcctcccattgtaactttccagctcatcccgaaaggcagccttgctcaagcagctggg
gctccccagacacagtccggctgccccccagctgtggcaggccccttgccctctatgtac
cagatcccagagatggcccgtttgcccagtgtggctttcccacctaccatgatgccccag
caggaggggcaggtagctcagaccattgtcccaacctatcaccctttcccagcctctgtg
ggcaagtaccccacacccccttcccaacacagttatgcctcctcaaatgctgccgagcgc
acccccaatcatggtggtcacctccagggcgagcacccgtacctgacaccatccccagag
tctcctgaccaatggtcgagctcttcaccgcactctgcgtctgactggtcagatgtgacc
accagcccaactcctggagggggtggaggcggtcagcggggacctggaacacacatgtcc
gagccaccacacagcaacatgcaggtttatgcatga

DBGET integrated database retrieval system