KEGG   Rattus norvegicus (rat): 294924
Entry
294924            CDS       T01003                                 

Gene name
Mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno05200  Pathways in cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    294924 (Mecom)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    294924 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    294924 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    294924 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    294924 (Mecom)
   03036 Chromosome and associated proteins [BR:rno03036]
    294924 (Mecom)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     294924 (Mecom)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    294924 (Mecom)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     294924 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zf-met PyrI_C
Other DBs
NCBI-GeneID: 294924
NCBI-ProteinID: NP_001376211
RGD: 1310997
Ensembl: ENSRNOG00000012645
Position
2
AA seq 1242 aa
MRSKGRARKLATSNECAYGNYPEIPLEEMPDAEDADGIANAPSLHIQEPCSPATSSESFT
PKEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDL
KDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVA
DIAPGEELLLFMKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHS
AFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCP
KAFNWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKT
FATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFST
TSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMGHANPGLVDYFGTNRHP
AGLTFPTAPGFSLSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQSNKCQSPLLTHPQILP
ATQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETT
SGSDLESDLESDKEKCKENGKMFKDKVSPLQNLASINNKKEYSNHSVFSASVEEQTAVSG
AVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLR
SLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGSSKLPATPATSQDQPLDLS
MGSRSRASGTKLTEPRKNHVFGEKKGSNMETRPSSDGSLQHARPTPFFMDPIYRVEKRKL
TDPLEALKEKYLRPSPGFLFHPQFPLPDQRTWMSAIENMAEKLESFSGLKPEASELLQSV
PSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDR
SFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSE
LESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDEKALATSQNSDLL
DDEEVEDEVLLDEEDEDNDIPGKPRKELGVTNLDEEIPEDDYEEAGALEMSCKVSPVRYK
EEDYKSGLSALDHIRHFTDSLKMREMEENQYTDAELSFGSSHVPEELKQPLHRKSKSQAY
AMMLSLSDKDALHPTSHGSSNVWHSMARAAAESSAIQSISHV
NT seq 3729 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcttatggcaac
taccctgaaatacccttggaagaaatgccagatgccgaagatgcagatgggatagccaat
gctccctcccttcacatccaagagccatgctctcctgcgacatccagtgagtcatttact
cctaaggagggctcgccctacaaagcccccatctacatccccgatgacatccccattcct
gatgaattcgagcttcgagagtcaactatgcctggagcaggacttggaatatggaccaaa
aggaagattgaaataggagaaaagtttgggccatacatgggagagcagagatcagacctg
aaagattccagctatggatgggagatcttagatgagttttgcaatgtgaagttctgcata
gatgccagtcaaccagatgtaggaagctggctcaagtacatccgattcgctggctgctac
gatcagcacaaccttgttgcatgccagataaacgatcagatattctacagagtagtcgca
gacattgcgcctggggaggaactcctgctgttcatgaagagtgaagaggacccacatgag
cccatggcgcctgacatccatgaagaacggcagcaccgctgtgaggactgtgaccagctc
tttgaatccaaggctgagctggctgatcaccagaagttcccatgcagcacacctcactcg
gccttctccatggtggaggaggacttgcagcaaaacctggagagtgagagtgatctccga
gagatccatggcaaccaggactgtaaggaatgtgaccgagttttccccgatctacaaagc
ttggagaagcacatgttgtcacacactgaggagagggaatacaagtgtgatcagtgcccc
aaggcatttaactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaag
cactatgagtgtgaaaactgtgccaagcaggttttcacggaccctagcaaccttcagcga
cacattcgatctcagcatgttggtgcccgggctcatgcttgcccggagtgtggtaaaaca
tttgccacttcgtcaggcctcaaacaacacaagcacatccacagcagtgtgaagcccttt
atctgtgaggtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgc
atgcatgctgattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcact
acgtcttccttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggt
ggattttttggccaaggcatttcacttcctggaaccccagctatggataaaacgtccatg
gttaatatgggccacgccaacccgggcctggttgactattttggcaccaataggcatcct
gctggtcttacctttccaacagctccgggattttccttgagctttcctggtctgtttcct
tcgggcttgtaccacaggcctcctttgatacccgctagctctcctgttaaaggactatca
agtaccgaacagtcaaacaaatgtcaaagtcccctcttgacacatcctcagatactgcca
gccacccaggatattttgaaggcactatctaaacacccacctgtaggggacaataagcca
gtggaactgctgcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccag
tcagagagtagtgaccttgatgatgtcagtacgccaagtggcagtgatctggaaacaacc
tcgggctctgatctggaaagtgaccttgaaagtgataaagagaaatgtaaagaaaatggt
aaaatgttcaaagacaaagtaagccctctgcagaatctggcttcaataaataataagaaa
gaatacagcaatcattccgttttctcagcatctgtagaggagcagaccgcggtgtcagga
gctgtgaatgattctataaaggctattgcgtctattgctgaaaaatactttggttccaca
ggactggtggggctgcaagacaaaaaagtcggagcgttaccttacccttccatgtttccc
ctcccgttttttccagcattctctcaatcaatgtacccatttcctgatagagacttgagg
tcgttacctttgaaaatggagccccaatcaccaagtgaagtaaagaaactgcagaaggga
agctctgagtccccttttgacctcaccactaagagaaaggacgagaagcccttgacttca
ggctcctcaaagcttccagcaacacccgccacaagccaagaccagcccctggatctaagt
atgggcagtaggagtagagccagtgggacaaagttgactgagcctcgaaaaaaccatgtg
tttggggaaaagaaaggaagcaacatggaaacaaggccatcttcagatggctccttgcag
catgccagacccactcccttcttcatggatcccatttatagagtagagaaaagaaagctc
actgatccgcttgaagctttgaaagaaaaatacttgagaccttctccaggattcttgttt
cacccacaattcccactacctgaccagagaacatggatgtcggctatcgagaacatggcg
gaaaaactagaaagcttcagcggcctgaaaccagaggccagcgagctcctgcagtcagtg
ccctctatgttcagcttccgggctcctcccaacaccctgccagagaacctgctgcggaag
ggaaaggaacgctatacctgcaggtactgtggtaagattttcccaaggtctgcaaaccta
acacggcatttgagaacccacacaggagagcaaccttacagatgcaaatactgcgataga
tcattcagtatttcctccaacctgcagcgacacgtgcgcaacattcacaacaaggagaag
ccatttaagtgtcacctatgtgacagatgctttggtcaacaaaccaatcttgacagacac
ctgaagaaacacgagaacgggaacatgtctggtacagcaacatcctcgcctcattcggag
ctagaaagcgcaggtgccatcctggatgacaaagaagatgcttactttacagagatccgc
aatttcatcgggaatagcaaccatgggagccagtctcctcggaacatggaggagaggatg
aatggcagtcacttcaaggatgaaaaggctttggcgaccagccaaaattccgatttattg
gatgacgaagaagtagaggatgaggtgttgctggatgaggaggatgaagacaatgatatt
cctggaaaacccagaaaggagctgggggtaactaatttagatgaggaaatccctgaggat
gactatgaggaagccggtgccctggagatgagttgtaaggtgtcccccgtgaggtataaa
gaggaagactataaatctggcctttctgctctagatcacataaggcacttcacagatagc
ctcaaaatgagggaaatggaagagaatcaatacactgacgctgagctgtcctttggttct
tctcatgtgccagaggagcttaaacagccgttacacagaaagtccaaatcacaggcatat
gctatgatgttgtcactgtctgacaaggatgccctccatcccacctcccacggttcctcc
aacgtgtggcacagcatggcaagagctgcagcggaatccagtgccatccagtccataagc
catgtatga

DBGET integrated database retrieval system