KEGG   Rattus norvegicus (rat): 294924
Entry
294924            CDS       T01003                                 

Gene name
Mecom, Evi1, Mds1
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05200  Pathways in cancer
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    294924 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    294924 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    294924 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    294924 (Mecom)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    294924 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_11 zf-C2H2_jaz zf-C2H2_6 PyrI_C zf-BED zf-C2H2_8 zf-Di19
Other DBs
NCBI-GeneID: 294924
NCBI-ProteinID: NP_001099893
RGD: 1310997
Ensembl: ENSRNOG00000012645
Position
2q24
AA seq 917 aa
MTVESTMSVKTVPSRFSRTLATFSDTFDLSMLVPGLMLARSVVKHLPLRQASNNTSSEVC
HKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQ
GISLPGTPAMDKTSMVNMGHANPGLVDYFGTNRHPAGLTFPTAPGFSLSFPGLFPSGLYH
RPPLIPASSPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKHPPVGDNKPVELLP
ERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESDKEKCKENGKMFKD
KVSPLQNLASINNKKEYSNHSVFSASVEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGL
QDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESP
FDLTTKRKDEKPLTSGSSKLPATPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKK
GSNMETRPSSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFP
LPDQRTWMSAIENMAEKLESFSGLKPEASELLQSVPSMFSFRAPPNTLPENLLRKGKERY
TCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCH
LCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESAGAILDDKEDAYFTEIRNFIGN
SNHGSQSPRNMEERMNGSHFKDEKALATSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKPR
KELGVTNLDEEIPEDDYEEAGALEMSCKVSPVRYKEEDYKSGLSALDHIRHFTDSLKMRE
MEENQYTDAELSFGSSHVPEELKQPLHRKSKSQAYAMMLSLSDKDALHPTSHGSSNVWHS
MARAAAESSAIQSISHV
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgacagtggaaagcactatgagtgtgaaaactgtgccaagcaggttttcacggacccta
gcaaccttcagcgacacattcgatctcagcatgttggtgcccgggctcatgcttgcccgg
agtgtggtaaaacatttgccacttcgtcaggcctcaaacaacacaagcagtgaggtctgc
cataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgattgc
agaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaat
aaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggccaa
ggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgggccac
gccaacccgggcctggttgactattttggcaccaataggcatcctgctggtcttaccttt
ccaacagctccgggattttccttgagctttcctggtctgtttccttcgggcttgtaccac
aggcctcctttgatacccgctagctctcctgttaaaggactatcaagtaccgaacagtca
aacaaatgtcaaagtcccctcttgacacatcctcagatactgccagccacccaggatatt
ttgaaggcactatctaaacacccacctgtaggggacaataagccagtggaactgctgccc
gagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagtagtgac
cttgatgatgtcagtacgccaagtggcagtgatctggaaacaacctcgggctctgatctg
gaaagtgaccttgaaagtgataaagagaaatgtaaagaaaatggtaaaatgttcaaagac
aaagtaagccctctgcagaatctggcttcaataaataataagaaagaatacagcaatcat
tccgttttctcagcatctgtagaggagcagaccgcggtgtcaggagctgtgaatgattct
ataaaggctattgcgtctattgctgaaaaatactttggttccacaggactggtggggctg
caagacaaaaaagtcggagcgttaccttacccttccatgtttcccctcccgttttttcca
gcattctctcaatcaatgtacccatttcctgatagagacttgaggtcgttacctttgaaa
atggagccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgagtcccct
tttgacctcaccactaagagaaaggacgagaagcccttgacttcaggctcctcaaagctt
ccagcaacacccgccacaagccaagaccagcccctggatctaagtatgggcagtaggagt
agagccagtgggacaaagttgactgagcctcgaaaaaaccatgtgtttggggaaaagaaa
ggaagcaacatggaaacaaggccatcttcagatggctccttgcagcatgccagacccact
cccttcttcatggatcccatttatagagtagagaaaagaaagctcactgatccgcttgaa
gctttgaaagaaaaatacttgagaccttctccaggattcttgtttcacccacaattccca
ctacctgaccagagaacatggatgtcggctatcgagaacatggcggaaaaactagaaagc
ttcagcggcctgaaaccagaggccagcgagctcctgcagtcagtgccctctatgttcagc
ttccgggctcctcccaacaccctgccagagaacctgctgcggaagggaaaggaacgctat
acctgcaggtactgtggtaagattttcccaaggtctgcaaacctaacacggcatttgaga
acccacacaggagagcaaccttacagatgcaaatactgcgatagatcattcagtatttcc
tccaacctgcagcgacacgtgcgcaacattcacaacaaggagaagccatttaagtgtcac
ctatgtgacagatgctttggtcaacaaaccaatcttgacagacacctgaagaaacacgag
aacgggaacatgtctggtacagcaacatcctcgcctcattcggagctagaaagcgcaggt
gccatcctggatgacaaagaagatgcttactttacagagatccgcaatttcatcgggaat
agcaaccatgggagccagtctcctcggaacatggaggagaggatgaatggcagtcacttc
aaggatgaaaaggctttggcgaccagccaaaattccgatttattggatgacgaagaagta
gaggatgaggtgttgctggatgaggaggatgaagacaatgatattcctggaaaacccaga
aaggagctgggggtaactaatttagatgaggaaatccctgaggatgactatgaggaagcc
ggtgccctggagatgagttgtaaggtgtcccccgtgaggtataaagaggaagactataaa
tctggcctttctgctctagatcacataaggcacttcacagatagcctcaaaatgagggaa
atggaagagaatcaatacactgacgctgagctgtcctttggttcttctcatgtgccagag
gagcttaaacagccgttacacagaaagtccaaatcacaggcatatgctatgatgttgtca
ctgtctgacaaggatgccctccatcccacctcccacggttcctccaacgtgtggcacagc
atggcaagagctgcagcggaatccagtgccatccagtccataagccatgtatga

DBGET integrated database retrieval system