KEGG   Rattus norvegicus (rat): 29657
Entry
29657             CDS       T01003                                 

Gene name
Arntl
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    29657 (Arntl)
  09159 Environmental adaptation
   04710 Circadian rhythm
    29657 (Arntl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29657 (Arntl)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    29657 (Arntl)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 29657
NCBI-ProteinID: NP_077338
RGD: 62003
Ensembl: ENSRNOG00000014448
UniProt: Q9EPW1 D3ZT62
Position
1
AA seq 626 aa
MADQRMDISSTISDFMSPGPTDLLSGSLSTSGVDCNRKRKGSATDYQESMDTDKDDPHGR
LEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DSEPDNEGCNLSCLVAIGRLHSHMVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSAGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggcggaccagagaatggacatttcctccacaatcagtgacttcatgtctccgggcccc
accgacctgctctccggttccctgagcaccagtggtgtggactgcaaccgcaagaggaaa
ggcagtgccactgactaccaagaaagtatggacacagacaaagatgaccctcatggaagg
ttagaatatgcagaacaccaaggaaggatcaaaaatgcaagggaggcccacagtcagatt
gaaaagaggcgtcgggacaaaatgaacagttttattgacgaattggcttctttggtacca
acatgcaatgcgatgtcccggaagttagataaactcaccgtgctcaggatggctgttcag
cacatgaaaacattgagaggtgccaccaacccatacacagaagcaaactacaagccaaca
tttctatccgatgacgaactgaaacacctaattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatcctctttgtctccgaatctgtcttcaagatcctc
aattatagccagaatgaccttattggccagagtttgttcgactacctgcatccaaaagat
attgccaaagttaaggaacagctatcttcctcggacactgcacctcgggagcgactcatc
gatgcgaagactggacttccggttaaaacggatataacccctgggccctcccgattgtgc
tctggagctcggcgctctttcttctgtaggatgaagtgcaacaggccttcagtaaaggtg
gaagataaggacttcgcctccacctgttcaaagaaaaaagcagatcgaaagagcttctgc
acaatccacagcacaggctacttgaaaagctggccacccacaaagatggggctggacgaa
gacagtgaaccagacaatgagggctgcaatctgagctgcctcgttgcaatcgggcgactg
cactcacacatggttccacagccagtgaacggggaaatacgggtgaagtctatggagtat
gtgtctcgacatgcaatagatgggaaatttgtttttgtagatcagagggcgacggctatt
ttggcatatctaccacaggaacttctaggtacatcgtgttatgagtattttcatcaagat
gatataggacaccttgcggaatgtcacaggcaagttttacagacaagagaaaagatcacg
actaattgctataagtttaagatcaaagatggttcctttatcacactacgaagtcgatgg
ttcagtttcatgaacccgtggaccaaggaagtagaatacattgtctcaaccaacactgtt
gttttagccaatgtcctggaaggcggggacccaaccttcccacagctcacagcatccccc
cacagcatggacagcatgctgccctctggagaaggtggcccaaagaggactcatcccact
gttccaggcattccagggggaaccagagctggagcaggaaaaataggtcgaatgattgcc
gaggaaatcatggaaatccacaggataagagggtcatcaccttccagctgtggctccagc
ccactgaacatcacaagtacgcctccccctgatgcttcctctccaggaggcaagaagatt
ctaaatggagggactccagacattccttccgctggcctactaccagggcaggctcaggag
accccaggctatccctactctgatagttcgtctattcttggtgagaacccccacataggc
atcgacatgatagacaacgaccaaggatcaagcagccccagtaacgacgaggcagcaatg
gctgtcatcatgagcctcttggaagcagatgcggggctgggtggtcccgttgactttagt
gacttgccatggccactgtag

DBGET integrated database retrieval system