KEGG   Rattus norvegicus (rat): 297902
Entry
297902            CDS       T01003                                 

Gene name
Gem
Definition
(RefSeq) GTP binding protein overexpressed in skeletal muscle
  KO
K07846  GTP binding protein overexpressed in skeletal muscle
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    297902 (Gem)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Rad/Gem/Kir [OT]
    297902 (Gem)
SSDB
Motif
Pfam: Ras Roc RsgA_GTPase FeoB_N ABC_tran AAA_22 MMR_HSR1 AAA_33 AAA_24 AAA_16 AAA_5 AAA_28 VirE DUF2369 AAA_29
Other DBs
NCBI-GeneID: 297902
NCBI-ProteinID: NP_001100107
RGD: 1307386
Ensembl: ENSRNOG00000015160
UniProt: B5DFA6
Position
5q13
AA seq 295 aa
MTLNNVTMRQGTVGMQPQQRWSIPADGRHLMVQKDPHPCNPHNHHSTAPDDHCRRSWSSE
STDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVD
GESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQT
EDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRL
RRDSKEKNERRLAYQKRRESIPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgactctgaataacgtcaccatgcgccaaggcactgtgggcatgcagccacagcaacgc
tggagcatccctgctgatggcaggcatctgatggtccagaaggatccccacccctgcaac
ccccacaaccaccactccactgctcccgatgaccactgccggcggagctggtcctccgag
tccacagactcggttatctcttccgagtcaggaaacacctactaccgagtggtgcttatt
ggggagcaaggagtgggcaagtccaccctggccaacatctttgcaggtgtacatgacagc
atggacagcgactgtgaggtcttgggagaagatacatatgagcgtaccctggtcgttgat
ggagagagtgcaaccattatcctactggacatgtgggaaaataagggggagaatgaatgg
ctccacgaccactgcatgcaggtcggggacgcctacctgatcgtctactccatcacagac
cgggcgagctttgagaaggcgtctgagctgaggatccagctccgcagggcccggcagaca
gaagacattcctataattttggttggcaacaaaagcgacttagtgcggtgtcgagaagtg
tctgtgtcagaagggagagcttgtgccgtggtgttcgactgcaaattcatcgagacctct
gcagccgtgcagcacaacgtgaaggaactgtttgagggcattgtgcggcaggtccgtctg
cgtcgggacagcaaggaaaagaacgagaggaggctggcctaccagaagaggcgggagagt
atccccaggaaagccagacgcttctggggcaaaattgtagccaaaaacaacaagaacatg
gctttcaagctcaagtcaaaatcctgccatgacctgtctgtgctctag

DBGET integrated database retrieval system