KEGG   Rattus norvegicus (rat): 298845
Entry
298845            CDS       T01003                                 

Gene name
Emilin1
Definition
(RefSeq) elastin microfibril interfacer 1
  KO
K24246  emilin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    298845 (Emilin1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 C1q domain-containing proteins
  Emilin / mutimerin group proteins
   298845 (Emilin1)
SSDB
Motif
Pfam: C1q Collagen DUF5713 OCRE HAUS-augmin3
Other DBs
NCBI-GeneID: 298845
NCBI-ProteinID: NP_001100180
RGD: 1311209
Ensembl: ENSRNOG00000008246
UniProt: D3Z9E1
Position
6q14
AA seq 900 aa
MEWRCCQGYGGDDCGEGPASVLGPAPSTPLPRPRPARPNLSGSSAGSHLSGLGGEGPGET
EKVQQLEQQVKSLTKELQGLRGVLQGMNGRLAEDVQRAVEAAFNGRQQPADAAARPGVHE
TLNEIQQQLQLLDNRVSTHDQELGHLNNHHNGGPGGSGRASAPVPVPSGPSEELLRQLER
QLQESCSVCLAGLDGFRQQQQEDRERLRTLEKLMSSMEERQQQLMGPAMARRPPQECCPP
ELGRRVSELERRLDVVAGSVTVLSGRRGSELGGAAGQGGHPPGYTSLASRLSHLEDRFNS
TLGPSEEQEKNWPGGPGRLGQWLPAAPGQLEKLEVLLANVSRELGGRLDLLEEQVAGAVR
ACGQICSEGPGEQDSRVSEILSALERRVLDSEGQLRLVGSGLHKAETAGEAQQAMLEGLQ
GILGRLQERMDTQEETAAELSLRLNLTAAQLSQLEGLLQARGDEGCGACGGVQEELGRLR
DGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGFSVFGGGSGSALQALQGELSEVILTFSS
LNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEHITEIEERFRGLEEGQAQ
AGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAAVRESNSTSLTQAALL
EKLLGGQAGLGRRLGALNSSLLLLEDRLQQLSLKDFTGPSGKAGPPGPPGLQGPPGPAGP
PGPPGKDGQRGAIGPPGPQGEQGVEGAPAAPVPRVAFSAALSLPRSEPGTVPFDRVLLND
GGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNLGVARIDSGGYEPEGLENK
PVAESQPSPGALGVFSLILPLQVGDTVCIDLVMGQLAHSEEPLTIFSGALLYEDTDLEQV
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggagtggaggtgctgtcaggggtatgggggcgatgactgcggagagggtcctgcttct
gttctgggccctgcaccctccacaccacttccccggcccaggcctgcgcgtcccaacctg
tctggctccagtgccggcagccacctcagtggactaggaggagaaggccctggtgagaca
gagaaggtgcagcagctagagcagcaggtaaagagtctgaccaaagagctgcaaggcctt
cgaggtgtccttcagggaatgaatgggcgcctggcagaagatgtacagagggctgtggag
gcggcctttaatgggaggcagcagccagcagatgcagctgcccgcccaggtgtgcacgaa
accctcaatgagatccagcagcagctgcagctcctggacaaccgtgtctccacccatgac
caggaactgggccaccttaacaaccatcataatggaggccctggtggaagcggcagggcc
tcagcccctgtccctgttccttctggccccagcgaggaactgttaaggcagctggaacgg
cagctgcaggagtcttgctcagtgtgcctggcagggctggatggcttccgccagcagcaa
caagaggatagggagcggctgcgaaccctggagaagctgatgtcctctatggaggagcgg
cagcagcagcttatgggacctgccatggccagaagaccccctcaggaatgctgccccccg
gagctgggtcggagagtgtcagagctggaacggaggctggatgtggtggctggctcggtg
acagtgctaagcggacgtagaggttctgagctcggaggagcagcagggcaggggggccat
cccccggggtacaccagcttggcctcccgcctttctcacctggaggaccgcttcaactct
accctaggtccctcagaggaacaagagaagaactggcctggaggaccagggaggctgggc
cagtggttgcctgctgctcctggacagctggaaaagctggaggtgctactagccaatgtg
agcagggagctgggtggccgcctagatctattggaagagcaggtggcaggggctgttagg
gcttgtggtcagatctgttccgaggggcctggggaacaggactctcgggtcagtgagatc
ctcagtgccttggagcgcagggtgctggacagcgagggccagttaaggctggtgggttca
ggcttacacaaagcagaaacggcaggggaggcccagcaggccatgttggagggactgcaa
gggattctgggccggcttcaggagcgcatggacacacaggaagagacagcagcagaactc
tcactgcgcctcaatcttaccgcagcccagctaagccaactggagggtctgctgcaagcc
cgtggggacgagggctgtggtgcctgtggtggtgtccaggaggagctaggccgtcttcgg
gatggtgtggaacgttgctcctgcccattgttacctccacggggccctggagctggccca
ggggttgggggcccaagccgtgggcctctggacggtttcagtgtgtttgggggcggctcg
ggctcagccctccaggcccttcaaggagaactctctgaggttattctcaccttcagctcc
cttaatgactcactgcatgagctccagaccactgtggagggccagggcgctgatctggct
gacctgggggccaccaaggacagcatcatctctgagatcaacaggctacagcaggaggcc
acagagcacattacagagatcgaggagcgtttccgaggcctggaggaaggccaggcccag
gcgggccaatgccctagcttagaggggcgactaggccgccttgagggagtttgtgaacga
ctggacactgtggcagggggactacaaggcctccgtgaaggcctttccagacacgtggcc
gggctctgggctgcagtaagggaaagcaacagtaccagtctgacgcaggccgcactgctg
gagaagctgctggggggccaggcaggcctgggcaggcggcttggtgccctcaacagttcc
ctgctgctcctagaagaccgtctgcagcaacttagcctaaaggacttcactggaccttca
ggcaaggctgggccccctgggcctcctgggctacaagggcctccaggccctgcaggacct
ccaggacctcctggcaaagatggacaaaggggggccattggaccaccaggtcctcaaggt
gaacagggagtggagggagcaccagcagcccccgtgcctagggtggcattttcagctgcc
ctgagtttgcctcggtcagaacccggcacagtccccttcgacagagtcttgctcaacgat
ggaggctactatgacccagagacaggtgtattcactgcgccactggctgggcgctacttg
ctgagcgctgtacttacagggcaccggcacgagaaagtggaggcagtactgtcccgctcc
aacctgggcgtggcccgcatagactcgggaggctatgaacccgagggactggagaataaa
cctgtggccgaaagtcagcctagcccgggcgctctgggagtcttcagcctcatcctgcca
ctgcaggtcggagacactgtctgcatcgacctggtcatggggcagctggcacactcagag
gagccgcttaccatcttcagcggagccctgctttacgaggacacagaccttgaacaggtg
tag

DBGET integrated database retrieval system