KEGG   Rattus norvegicus (rat): 298845Help
Entry
298845            CDS       T01003                                 

Gene name
Emilin1
Definition
(RefSeq) elastin microfibril interfacer 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen OCRE
Motif
Other DBs
NCBI-GeneID: 298845
NCBI-ProteinID: NP_001100180
RGD: 1311209
Ensembl: ENSRNOG00000008246
UniProt: D3Z9E1
Position
6q14
AA seq 900 aa AA seqDB search
MEWRCCQGYGGDDCGEGPASVLGPAPSTPLPRPRPARPNLSGSSAGSHLSGLGGEGPGET
EKVQQLEQQVKSLTKELQGLRGVLQGMNGRLAEDVQRAVEAAFNGRQQPADAAARPGVHE
TLNEIQQQLQLLDNRVSTHDQELGHLNNHHNGGPGGSGRASAPVPVPSGPSEELLRQLER
QLQESCSVCLAGLDGFRQQQQEDRERLRTLEKLMSSMEERQQQLMGPAMARRPPQECCPP
ELGRRVSELERRLDVVAGSVTVLSGRRGSELGGAAGQGGHPPGYTSLASRLSHLEDRFNS
TLGPSEEQEKNWPGGPGRLGQWLPAAPGQLEKLEVLLANVSRELGGRLDLLEEQVAGAVR
ACGQICSEGPGEQDSRVSEILSALERRVLDSEGQLRLVGSGLHKAETAGEAQQAMLEGLQ
GILGRLQERMDTQEETAAELSLRLNLTAAQLSQLEGLLQARGDEGCGACGGVQEELGRLR
DGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGFSVFGGGSGSALQALQGELSEVILTFSS
LNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEHITEIEERFRGLEEGQAQ
AGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAAVRESNSTSLTQAALL
EKLLGGQAGLGRRLGALNSSLLLLEDRLQQLSLKDFTGPSGKAGPPGPPGLQGPPGPAGP
PGPPGKDGQRGAIGPPGPQGEQGVEGAPAAPVPRVAFSAALSLPRSEPGTVPFDRVLLND
GGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNLGVARIDSGGYEPEGLENK
PVAESQPSPGALGVFSLILPLQVGDTVCIDLVMGQLAHSEEPLTIFSGALLYEDTDLEQV
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaggtgctgtcaggggtatgggggcgatgactgcggagagggtcctgcttct
gttctgggccctgcaccctccacaccacttccccggcccaggcctgcgcgtcccaacctg
tctggctccagtgccggcagccacctcagtggactaggaggagaaggccctggtgagaca
gagaaggtgcagcagctagagcagcaggtaaagagtctgaccaaagagctgcaaggcctt
cgaggtgtccttcagggaatgaatgggcgcctggcagaagatgtacagagggctgtggag
gcggcctttaatgggaggcagcagccagcagatgcagctgcccgcccaggtgtgcacgaa
accctcaatgagatccagcagcagctgcagctcctggacaaccgtgtctccacccatgac
caggaactgggccaccttaacaaccatcataatggaggccctggtggaagcggcagggcc
tcagcccctgtccctgttccttctggccccagcgaggaactgttaaggcagctggaacgg
cagctgcaggagtcttgctcagtgtgcctggcagggctggatggcttccgccagcagcaa
caagaggatagggagcggctgcgaaccctggagaagctgatgtcctctatggaggagcgg
cagcagcagcttatgggacctgccatggccagaagaccccctcaggaatgctgccccccg
gagctgggtcggagagtgtcagagctggaacggaggctggatgtggtggctggctcggtg
acagtgctaagcggacgtagaggttctgagctcggaggagcagcagggcaggggggccat
cccccggggtacaccagcttggcctcccgcctttctcacctggaggaccgcttcaactct
accctaggtccctcagaggaacaagagaagaactggcctggaggaccagggaggctgggc
cagtggttgcctgctgctcctggacagctggaaaagctggaggtgctactagccaatgtg
agcagggagctgggtggccgcctagatctattggaagagcaggtggcaggggctgttagg
gcttgtggtcagatctgttccgaggggcctggggaacaggactctcgggtcagtgagatc
ctcagtgccttggagcgcagggtgctggacagcgagggccagttaaggctggtgggttca
ggcttacacaaagcagaaacggcaggggaggcccagcaggccatgttggagggactgcaa
gggattctgggccggcttcaggagcgcatggacacacaggaagagacagcagcagaactc
tcactgcgcctcaatcttaccgcagcccagctaagccaactggagggtctgctgcaagcc
cgtggggacgagggctgtggtgcctgtggtggtgtccaggaggagctaggccgtcttcgg
gatggtgtggaacgttgctcctgcccattgttacctccacggggccctggagctggccca
ggggttgggggcccaagccgtgggcctctggacggtttcagtgtgtttgggggcggctcg
ggctcagccctccaggcccttcaaggagaactctctgaggttattctcaccttcagctcc
cttaatgactcactgcatgagctccagaccactgtggagggccagggcgctgatctggct
gacctgggggccaccaaggacagcatcatctctgagatcaacaggctacagcaggaggcc
acagagcacattacagagatcgaggagcgtttccgaggcctggaggaaggccaggcccag
gcgggccaatgccctagcttagaggggcgactaggccgccttgagggagtttgtgaacga
ctggacactgtggcagggggactacaaggcctccgtgaaggcctttccagacacgtggcc
gggctctgggctgcagtaagggaaagcaacagtaccagtctgacgcaggccgcactgctg
gagaagctgctggggggccaggcaggcctgggcaggcggcttggtgccctcaacagttcc
ctgctgctcctagaagaccgtctgcagcaacttagcctaaaggacttcactggaccttca
ggcaaggctgggccccctgggcctcctgggctacaagggcctccaggccctgcaggacct
ccaggacctcctggcaaagatggacaaaggggggccattggaccaccaggtcctcaaggt
gaacagggagtggagggagcaccagcagcccccgtgcctagggtggcattttcagctgcc
ctgagtttgcctcggtcagaacccggcacagtccccttcgacagagtcttgctcaacgat
ggaggctactatgacccagagacaggtgtattcactgcgccactggctgggcgctacttg
ctgagcgctgtacttacagggcaccggcacgagaaagtggaggcagtactgtcccgctcc
aacctgggcgtggcccgcatagactcgggaggctatgaacccgagggactggagaataaa
cctgtggccgaaagtcagcctagcccgggcgctctgggagtcttcagcctcatcctgcca
ctgcaggtcggagacactgtctgcatcgacctggtcatggggcagctggcacactcagag
gagccgcttaccatcttcagcggagccctgctttacgaggacacagaccttgaacaggtg
tag

DBGET integrated database retrieval system