KEGG   Rattus norvegicus (rat): 301012Help
Entry
301012            CDS       T01003                                 

Gene name
Col7a1
Definition
(RefSeq) collagen type VII alpha 1 chain
  KO
K16628  collagen, type VII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    301012 (Col7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen fn3 VWA VWA_2 Pur_ac_phosph_N DUF4992
Motif
Other DBs
NCBI-GeneID: 301012
NCBI-ProteinID: NP_001100328
RGD: 1311417
Ensembl: ENSRNOG00000020579
UniProt: D3ZE04
Position
8q32
AA seq 2588 aa AA seqDB search
MRLRLLVAALCTAEILVGAPGVWAQPRDRVTCTRLYAADIVFLIDGSSSIGRSNFREVRG
FLEGLVLPFSGAANAQGVRFATVQYSDDPQTEFGLDTLGSGGDTIRAIRELSYKGGNTRT
GAALLHVSDRVFLPHLTRPGIPKVCILITDGKSQDLVDTAAQKLKRQGVKLFAVGIKNAD
PEELKRIASQPTSDFFFFVNDFSILRTLLPLISRRVCTTAGGVPVTLPSDDTPSGPRDLV
LSEPSSQSLRVQWTAASGPVTGYKIQYTPLTGLGQPLPSERKEVNVPAGETSMRLQGLRP
LTDYQVTVVALYANSIGEAVSGTARTTAKEGLELSVQNITSHSLLVAWRRVPGANGYRVT
WRDLSGGGAQQQDLSPGQGSVFLDHLKPGTDYEVTVSALFGRSVGPAASLTTRTASSVEQ
TLRPIILSPTSILLSWNLVPEARGYRLEWHRESGLEPPQKVELLPDVTRYQLDGLQPGTE
YRLTLYTLLEGREVATPATVVPTGLEQLVGPVMNLQATELPGQRLRVSWNPVLGATEYRF
TVRTPQGVERTLLLPGSQTTFDLDDVRAGISYTVRVSARVGTHEGDASTLTIHRDQEAPL
IIPGLQVVASDATRIRVAWGLVPGASGFRISWRTGSGPESSQTLAPDSTVTDILGLQPGT
SYQVAVSALRGREEGPPVVIVARTDPLGPVRRVHLTQAGSSSVSITWTGVPGATGYRVSW
HSGHGPEKSQLVSGDATVAEIDGLEPDTEYIVRVRTHVAGVDGAPASVVVRTAPEPVGSV
SKLQILNASSDVLRVTWVGVPGATSYRLAWGRSEGGPMRHQIVPGNKDSAEITGLEGGVS
YSVRVTALVGDREGAPVSIVVTTPPEVPAPLETLQVVQSGEHSLRLHWNRVPGAQGFRLH
WQPEGGQEQSLTLGPESNSYNLVGLEPATKYHVWLSVLGQPGEAAPRKVTAYTETPHIPS
TGLRVVDTSVNSVTLTWTPVSGASSYILSWRPLRGTGQEVPGGPQTLPGNSSSHRVTGLE
PGVPYVFSLTPIQSGVRGSEITVTQKPACPHGQVDVVILLHATRDNAHNAEAVKRFLERL
VSALGPLGPQAAQVGLLSYSHRPSPLFPLNSSHDLGVILQKIRDIPYVDPSGNNLGTAVT
TAHRYLLAPNAPGRRRQVPGVMVLLVDEPLREDILSPIREAQASGLKVMMLGLVGADPEQ
LRLLAPGMDPIQTFFAVDNGLDLDRAGSDLAVALCQAAVAIQPQLEPCAVPCPKGQKGEP
GVTGPQGQAGPPGPPGLPGRTGAPGPQGAPGSTQAKGERGFPGPEGPPGSPGLPGVPGSP
GVKGSPGWSGPRGDRGERGPQGPKGEPGEPGQVIGGGRPGLPGKKGDPGPSGPPGPHGPL
GDPGPRGPPGLPGTSVKGDKGDRGERGPPGPGTGASEQGSPGLPGLPGSPGPQGPPGRTG
EKGEKGDCEDGGPGLPGQPGVPGEPGLRGAPGVTGPKGDRGLTGTPGEPGEKGERGPPGP
VGPQGLPGAAGRPGVEGPEGPPGPPGRRGEKGEPGRPGDPALGPGGAGAKGEKGDAGLPG
PRGASGIKGEQGAPGLALPGDPGPKGDPGDRGPIGLTGRAGPTGDSGPPGEKGEPGRPGS
PGPVGPRGRDGEAGEKGDEGAPGEPGLPGKAGERGLRGAPGPRGPVGEKGNEGDPGEDGR
NGTPGPSGPKGDRGEPGPPGLPGRLVDAALESRDKGEPGQEGPRGPKGDPGPPGASGERG
IDGLRGPPGPQGDPGVRGPAGDKGDRGSPGLDGRNGLDGKPGAPGPPGLHGASGKAGDPG
RDGLPGLRGEHGPPGPPGPPGVPGKPGDDGKPGLNGKNGEPGDPGEDGRKGEKGDSGVPG
REGPDGPKGERGAPGNPGLQGPPGLPGQVGPPGQGFPGVPGVTGPKGDRGETGSKGEQGL
PGERGLRGEPGSLPNAERFLETAGIKVSALREIVDTWGESSGSFLLVPERRQGPKGDPGD
PGPPGKEGSIGLPGERGLKGERGDPGPQGPPGLALGERGPPGPSGLAGEPGKPGIPGLPG
RAGAAGEAGRPGERGERGEKGERGEQGRDGHPGLPGPPGPPGPKVAIEELGPGPAREQGP
PGLKGAKGEPGSDGVPGPKGDRGVPGIKGDAGEPGKRGPDGNPGLPGERGVSGPEGKPGL
QGPRGTPGPVGSHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPGPTGAVGLP
GPPGPSGLVGPQGSPGLPGQVGETGKPGPPGRDGSSGKDGERGGPGVPGLPGLPGPVGPK
GEPGPVGAPGQVVVGPPGAKGEKGAPGDLAGALLGEPGAKGDRGLPGPRGEKGEAGHAGE
PGDPGEDGQKGAPGLKGLKGEPGIGVQGPPGPSGPPGMKGDLGPPGAPGAPGIVGFPGQP
GPRGETGQPGPVGERGLAGPPGREGAPGPLGPPGPPGSVGAPGASGFKGDKGDSGAGLPG
PRGERGEPGLRGEDGHPGQEGPRGLMGPPGSRGERGEKGDPGAAGLKGDKGDSAVIEGPA
GPRGAKGDMGERGPRGIDGDQGPRGESGDPGDKGSKGEPGDKGSAGSTGVRGLTGPKARR
ARCCRDPR
NT seq 7767 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcggctcctggtcgctgcgctctgcactgccgagatcctggtgggggcgccc
ggagtgtgggcccagcccagagatagagtgacctgcacccgcctttatgctgctgacatt
gtgttcttgattgacggctcctcgtccattggccgcagcaactttcgagaagtgcgggga
ttcctggaggggctggtgctgcctttctcaggagcagccaatgcacagggcgtccgattt
gcaacagtgcagtacagtgatgatccacagacagaatttggtctggatacacttggctct
gggggtgacaccattcgtgccatccgggagctcagctataagggtggtaacactcgaacg
ggggctgctcttctccacgtttccgaccgggtcttcctgcctcatctaacacgtcctggc
atccccaaggtctgtatcctgatcacagatgggaaatcccaggacttagtggacacagct
gcccaaaaactgaagaggcagggggtcaagctgtttgccgtgggaatcaagaacgccgat
cctgaggaactgaagcgcatcgcctcacagccaaccagcgatttcttcttctttgtcaat
gacttcagcatcttgaggaccctgttgcccctcatttcccggagggtgtgcaccacggct
ggtggtgtgcctgtgaccctgccttccgatgacactccgtctgggccccgggacctggtg
ctgtctgagccaagtagccaatccttacgagtacagtggacagcagccagtggccctgtg
actggctacaaaattcagtacacgcccctgacggggctaggacagccactgccaagtgag
cgaaaggaggtgaacgtcccggctggtgagaccagcatgcgactacagggtctccggcca
ctaactgactaccaagtgactgtggtggccctctatgctaacagcatcggagaggctgtg
agtgggacagctcggaccactgccaaggaagggctagagctgagcgtccagaacatcaca
tcccacagcctcctggtggcctggaggagggtaccaggtgctaatggctaccgcgtaaca
tggcgggacctcagtggtgggggggcacagcagcaggacctgagccctgggcaggggtca
gtgtttttagatcacttgaagcctggcacggactatgaggtgactgtgagcgccctattt
ggccgcagcgtggggcctgctgcttctctgactacccgcactgcctcttctgttgagcag
acactgcgccccatcatcctgagccccacatctattctcctttcctggaacttggtgcct
gaggcccgcggctaccgcctggagtggcatcgtgagagtggcttggaaccaccacagaaa
gtggaactgctccctgatgtgacccgctaccagttggatgggttgcagccaggcactgag
tatcgcctcacgctctacactctgctggagggccgtgaggtggccactcctgcgactgtg
gttcctactgggctagagcagctggtgggcccggtgatgaatttacaagccacagaacta
cctgggcagcggctgcgagtgtcttggaacccagtcctcggtgccaccgagtaccgtttc
actgtacgcaccccccagggggtcgagcggactttgttgcttcctgggagtcagacaacc
tttgacttagatgatgttcgagccgggattagctacacagtgcgagtgtctgctcgagtg
ggcactcatgagggtgatgccagcaccctcaccatccacagagatcaagaagccccactt
attatcccaggactgcaggttgtggcatcagatgcaacaagaattagagtggcctgggga
cttgtccctggagccagtggatttcggattagctggaggacaggcagtggtccagagtcc
agtcagacgctggccccagactctactgtcacagacatcctggggctgcagcctggaacc
tcttatcaagtggctgtgtcagcccttcgagggagagaagaggggccccctgtggtcatc
gtggctcgaactgatccactgggcccagtgaggagagtccacttgactcaggctggtagc
tcatctgtcagcattacctggactggggttcctggcgccaccggatacagggtttcctgg
cactcaggccatggtccagagaaatctcaattggtttctggggacgccacggtggctgaa
atagatggactggagccagacacagagtatatagtgcgtgtgagaacccatgtagccggt
gtggatggagccccggcctctgtggttgtgaggactgctcctgagcctgtaggcagtgtg
tcaaaactgcaaatccttaatgcttccagtgatgttctccgcgtcacttgggtgggagtc
cctggagccacatcctatagactggcttggggacgtagtgaaggtggacctatgagacac
cagatagtcccaggaaacaaagactctgcagagataacaggtctggaaggcggagtcagc
tactccgtgagagtgacggcgcttgttggagaccgagagggtgcacccgtgtccattgtc
gtcaccacaccgcctgaggtcccagcacctctggagacccttcaggtagtgcagagtggg
gagcactccttgaggctgcactggaaccgagtccccggagcacagggcttccgtctgcat
tggcaacctgagggtggccaggaacagtccctgaccttgggacctgagtctaacagctac
aacctggtcggactggagccagcaacgaagtaccatgtatggctgagtgtcctgggccag
cctggagaagctgcccctaggaaggtgactgcttacactgagactcctcacatcccgagc
actgggctacgggtggtggacacctctgtcaactcagtgactttgacctggaccccagtg
tctggggcatccagctatatcttgtcctggcggccactcagaggaactggccaggaagtg
ccggggggcccgcagacactgccagggaactcaagctcccacagagtgacaggcctggaa
cctggggttccctatgttttctctctgacacctatccagagcggtgtacgaggttctgag
atcactgtcacacaaaagccagcgtgtccccatggccaggtggacgtggtgatcctgtta
catgccactcgagacaacgctcacaatgcagaagctgtaaagaggttcctggaaaggctg
gtgtctgcactcgggcctcttggtccacaggctgctcaggttggcctgctgtcctacagc
caccggccctccccactgttcccgctgaatagttctcacgatcttggtgtcatcttgcaa
aagatccgtgacatcccctatgtggacccaagtggtaacaacctaggcacagccgtgacc
acagctcacagatacctcttagcacccaatgctcccggtcgccgtcggcaagtgccaggc
gtgatggtactgttagtggatgaacctctgagagaagacatattgagccccattcgtgag
gcccaggcttctgggctcaaggtgatgatgctgggtctggtgggagctgacccagagcag
ctgcgcctcttggcaccaggcatggaccccatccagaccttctttgctgtggataatggc
ttagacttggaccgagcaggcagtgatctggctgtagccctatgtcaggcagctgtggcc
atacagccacaactagagccttgtgctgtgccctgtccaaagggccagaagggggagcct
ggagtgacgggaccgcaaggacaggctggacctcctggtccccccggtctcccgggcagg
accggtgctccaggcccacaaggtgctcccggaagtacccaagcaaaaggcgagaggggc
tttcctggcccagaaggccctccaggcagtcctggcctacctggtgttcctgggtctcct
ggcgttaagggctccccagggtggtctggccctcgtggggatcggggagaacgagggcct
caaggcccaaaaggggagccgggggagcctgggcaagtcattggaggcggaaggccaggg
cttcctggaaagaaaggggaccctggaccttcgggaccccctggacctcatggccctttg
ggggacccaggacctcgtggcccccctgggcttcctggaacatcagtgaagggtgacaaa
ggtgaccgtggggaacggggtcccccaggaccaggcactggtgccagtgagcaaggcagc
cctggacttccggggcttcctggaagccctggaccccaaggcccacctggtcgaactgga
gagaagggagaaaagggtgactgtgaggatggaggcccaggccttccaggacagcctggg
gttccaggggaaccgggcctgcggggagctcctggagttactgggcccaaaggtgatcgg
ggactgacagggaccccgggtgagcctggagagaagggtgaacggggaccacctggtccc
gtgggaccccaggggcttcccggagctgctggacgtcctggagtggagggtcctgagggg
ccaccaggaccccctggccgccggggagaaaagggagagcctggtcgccctggggatcct
gcattgggccctggtggtgctggagccaagggagaaaagggagatgctgggctccctggg
cccagaggagcttctggaatcaaaggagagcagggtgcacctgggttggctcttcctgga
gaccctggccccaaaggagaccctggagacagaggtcccattggcctcactggcagggca
ggacccacaggtgactcagggcctcctggagagaagggagaacctgggcgacctggttcc
ccaggacctgttggccctcgaggaagagatggtgaagctggagagaaaggtgacgagggt
gccccgggtgagccaggtttgcctggaaaagcaggtgaacgcggcctccggggggcacct
gggccccgggggcctgtgggtgagaaggggaatgagggggatcctggagaagatggccgg
aatggcacccctggaccatctggacccaagggtgaccgtggggagccgggccccccgggt
ctccctggacggctggtggatgccgcccttgaatccagagacaagggagagcctggacag
gaaggtccccgaggacccaagggtgaccctggcccccctggagcctctggagaaaggggc
attgatgggcttcggggacccccaggcccacagggagacccaggtgttcgaggtcctgca
ggagacaagggtgatcggggatccccagggctggatggccgaaatgggctagatgggaaa
ccaggagcccctggccctccagggctacacggtgcttcagggaaagctggggaccctggg
agagatggacttccaggccttcgaggagaacatggcccacctggtccccctggccctcct
ggagtaccgggaaagccaggcgatgacggcaaacccggcctgaatgggaaaaacggagaa
cctggggatcccggagaagatggaaggaagggagaaaagggagattcgggtgtccctgga
agggaaggtcctgacggtcccaagggtgaacgcggagctcctggtaatcccggactccag
ggtcctccgggtctcccagggcaggtcggtcctcccggccagggtttccctggtgtccca
ggagttacaggtcctaagggtgaccgtggagagactggatccaaaggggaacagggcctt
cctggagaacgtggcctacgaggagaaccggggagcttgccgaatgcggagcggttcctg
gaaactgctggcatcaaggtgtcagccctgcgggagattgtggacacctggggtgagagt
tctggcagcttcctgctggtgcctgagcggagacaaggtcccaagggggaccctggtgac
ccaggccctccaggcaaggagggttccattggtcttcctggagaacgtgggctaaaggga
gaacgaggagaccctggccctcaggggcctcctggtctcgcccttggtgagaggggccca
cctggtccatctggccttgccggggaaccaggaaagcctggaattcctgggctcccaggt
cgggctggggctgcaggggaagcaggaaggccaggagagaggggagaaaggggagagaaa
ggagaacgcggggaacagggcagagatggccatcccggccttcctggaccacctggccct
cctggccccaaggtggccattgaagagctaggtcctggacccgctagagaacaaggacct
cctggactcaagggtgctaagggggagccaggcagtgatggtgtcccaggacccaaagga
gacaggggtgtacccggcatcaaaggagatgcaggagagccaggaaagaggggtcctgat
ggtaacccaggtctgccaggagagcgcggtgtgtctggacctgaagggaagccgggtctg
cagggcccgagggggacccctggcccagtgggtagccatggagacccaggaccacctggt
gccccgggtcttgctggccctgcagggccccagggaccttctggcctgaagggggagccc
ggagagacaggacccccaggacggggtctgcctggacctactggagctgtgggacttcct
ggccctcctggcccttcaggcctcgtgggcccacaaggctcaccaggtttgcccggacaa
gtgggggagacagggaagccaggacccccaggccgggatggtagcagcggaaaggacgga
gaaagaggaggccctggcgtgccagggttaccaggtctgcccggccctgttggacctaaa
ggagaacctggacctgtgggggcccctggacaggtggtggtcgggccccctggagcaaaa
ggcgagaagggagccccaggagaccttgctggagccctgctgggtgagccgggagccaag
ggtgaccgaggactgcctggaccacggggtgaaaagggtgaagctggccatgcaggagag
cctggcgaccctggggaagatggtcaaaaaggggctccaggactcaaaggtctcaagggc
gagccaggcattggggttcagggcccccctggcccaagtggtcctccaggtatgaaggga
gacttgggcccccctggtgcccccggtgctcctggtattgttggatttcctggtcagcca
ggacctcgaggagagacgggccagccagggcctgttggagagcggggtctggcaggccct
ccagggagagaaggtgccccaggtcccttgggaccacctggaccaccggggtcagtggga
gcacctggcgcctctggattcaaaggagacaagggagactcaggagcagggctgccaggg
ccccgaggcgagcgtggtgaaccaggtctccggggtgaagatggccaccctggccaggaa
ggacctcgtggactcatggggccccctggcagccggggagagcgaggagagaagggcgac
cctggtgctgcaggactcaagggtgacaagggtgactcagctgtgattgagggacctgca
gggccacgaggtgccaagggggatatgggtgaacgagggcctcgaggcatagatggtgac
caaggacctcggggtgaaagtggggatcctggggacaagggctccaaaggagagcctgga
gacaaaggctcggctggctccactggagttcgcggactcacaggacccaaggcaaggcga
gccaggtgctgcagggatccccggtga

DBGET integrated database retrieval system