KEGG   Rattus norvegicus (rat): 303068
Entry
303068            CDS       T01003                                 

Gene name
Adam19, Sox30
Definition
(RefSeq) ADAM metallopeptidase domain 19
  KO
K08608  disintegrin and metalloproteinase domain-containing protein 19 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    303068 (Adam19)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     303068 (Adam19)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   303068 (Adam19)
SSDB
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 EGF_2 ADAM_CR_2 Peptidase_M10 Zincin_1 Peptidase_M54
Other DBs
NCBI-GeneID: 303068
NCBI-ProteinID: NP_001153700
RGD: 1585017
Ensembl: ENSRNOG00000042980
UniProt: D3ZPM7
Position
10q21
AA seq 920 aa
MPGRAGVARFCLLALALQLQWPLAACEPEWTTRGSKEDSPPLQHELIIPQWRTSESPRGG
KHPLTAELRVMAEGRELILDLEKNEHLFAPAYTETCYTASGNPQTTTLKSEDHCFYHGTV
RKVDESSVTLSTCRGIRGLIIVRSNLSYIIEPVPNSDNQHRIYRSEHLKLPPGNCGFEHS
RPTSKDWTLQFTHQTKKQPRRMKREDLHSMKYVELYLVADYAEFQKNRHDQDATKHKLME
IANYVDKFYRSLSIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLTQKSHDNAQ
LITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDHSENAIGVASTVAHEIGHNFGMSHDSAH
CCSTSAADGGCIMAAATGHPFPKVFSSCNRKELDRYLQSGGGMCLSNMPDTRTLYGGRRC
GNGYLEDGEECDCGEEDECKNPCCNASNCTLKEGAECAHGSCCHQCKLVAPGTQCREQVR
QCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPALDL
CFERVNAAGDTYGNCGKGLNGKYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLN
GRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGK
KCNGHGVCNNNKNCHCFPGWAPPFCNTPGDGGSIDSGPLPPKSAGPVIAGVFSALFVLAV
LVLLCHCYRQSHKLGKPSALPFKLRQQFSCPFRVSQNGGTGHANPTFKLQTPQGKRKVTN
TPETLRKPSHPPPRPPPDYLRVESHPAPLPAHLNRAAGSSPEAGAQIERKESARRPPPSR
PMPPAPNCLLSQDFSRPRPPQKALPANPVPGQRTVPRPGGTSLFHPPTTGPQPPRPPAVS
VPKLPEYRSQRIGGITSSKI
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgcccgggcgcgcgggcgtcgcccggttctgcttgctggctctcgctctgcagctacag
tggccgctggcggcatgcgaaccggaatggaccacaagaggaagcaaagaagacagccct
ccactacaacatgaactcataatacctcagtggaggacttcagaaagccccaggggagga
aagcatccactcacggcagagctcagggtcatggctgaagggcgagagctgatcctggac
ctggagaagaacgagcacctttttgctccagcctacacagagacctgctacaccgcaagt
ggcaatcctcagaccaccacgctgaaatctgaggatcactgcttttaccacgggactgtg
aggaaagtggatgagtccagcgtcactctcagcacctgccggggaattagaggactgatt
atagtgagaagtaacctcagctacatcatcgagcccgtccctaacagcgacaaccaacac
cgtatttacagatccgaacatctcaagctgcccccggggaactgtgggttcgagcactcc
aggcccacctctaaggactggacccttcagtttacacatcagaccaaaaagcaacctcgc
agaatgaaacgggaagatttacactctatgaagtacgtggagctttatctggtggctgat
tacgcagagtttcagaagaaccggcatgaccaggatgccaccaaacacaagctcatggag
attgccaactatgttgataagttttaccgctccctgagcatccggattgcgcttgtcggc
ttggaggtgtggacacacggggataagtgtgaagtctcagagaatccgtactctaccctc
tggtcctttctcagttggaggcgcaagctgctcacccagaagagccatgacaatgcccag
ctaatcacgggcaggtccttccaaggcaccaccattggcctggcccccctcatggccatg
tgttctgtgtaccagtccggaggagttagcatggaccactccgagaatgccatcggtgta
gcctccaccgtggcccacgagattggccacaactttggcatgagccatgattctgcacac
tgctgttctaccagcgcagccgatggtgggtgcatcatggctgctgctacggggcaccct
ttccccaaagtgttcagttcgtgcaacaggaaggagctggacaggtatctgcagtcagga
ggtgggatgtgtctctccaacatgccagatacgaggactctgtatggaggccggaggtgt
ggcaatgggtacctggaagacggtgaagaatgtgactgcggagaagaggacgaatgtaag
aacccttgctgcaatgcctccaactgcactctgaaggaaggggccgagtgtgcccatggc
tcctgctgccaccagtgtaagctggtggctcctggaacccagtgtcgtgagcaggtgcgg
cagtgtgatctccccgagttctgcacgggcaagtccccccactgccccaccaactattac
cagatggatggcaccccctgcgagggtggccaggcctactgctacaatggcatgtgcctc
acttatcaggagcagtgccagcagctgtggggacctggagccaggcctgctcttgatctt
tgcttcgagagggtgaatgctgctggtgacacctatggtaactgcggcaaaggcttgaat
ggcaaatacaggaagtgcagccccagggatgccaagtgtgggaagatccagtgtcagagc
acccaggccaggcccctggaatccaacgcagtatctattgacaccaccattaccttgaac
gggaggcggatccactgtcggggcacccatgtctaccggggtcctgaggaggaagaaggg
gagggtgacatgctggacccagggctggtgatgaccgggaccaagtgtggccacaaccat
atttgcttcgaggggcaatgcaggaacacctccttctttgagacggaaggctgtgggaaa
aagtgcaatggtcatggggtctgcaacaacaacaagaactgtcattgcttccctggctgg
gctccacctttctgtaacaccccaggagatggcggcagcattgacagtgggcctttgccc
cctaagagtgcgggtcctgtgattgctggggtgttttctgccctcttcgtgttggcagtc
ctggtgctattgtgtcattgctacagacagagccacaaactgggcaagccctcagctctc
ccttttaagctgcggcaacagttcagttgtcccttcagggtgtctcagaatggtggaact
ggccacgccaacccaactttcaagttgcagacaccccagggcaagcgaaaggtgactaac
acccctgaaactctccggaagccctcccaccctcctccccggccccctccggactaccta
cgagttgaatcccatcctgcaccactgccagcacatctgaacagggctgctgggagctca
ccagaagctggagctcagatagaaagaaaggaatcagccagaagacctcccccaagccgg
cccatgccccctgcaccgaactgcctactgtcccaggatttctccaggcctcgaccacct
cagaaggcactcccagcgaatcctgtgccgggccaaaggactgttcccaggccaggaggc
acctccctgtttcatccccctactactggtcctcagcctcccaggcctccagcagtgtct
gttccaaagcttcctgagtaccgatcacagaggattggagggataaccagctccaagatc
tag

DBGET integrated database retrieval system