KEGG   Rattus norvegicus (rat): 303135Help
Entry
303135            CDS       T01003                                 

Gene name
Sept8
Definition
(RefSeq) septin 8
  KO
K16939  septin 6/8/11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    303135 (Sept8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    303135 (Sept8)
   04147 Exosome [BR:rno04147]
    303135 (Sept8)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     303135 (Sept8)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303135 (Sept8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AAA_22 RsgA_GTPase AAA_16 Roc AAA_7 Ras AIG1 RNA_helicase ABC_tran AAA_24 Microtub_bd IMD AAA_29 DUF87
Motif
Other DBs
NCBI-GeneID: 303135
NCBI-ProteinID: NP_001100472
RGD: 1308449
Ensembl: ENSRNOG00000007462
UniProt: G3V9Z6
Position
10q22
AA seq 429 aa AA seqDB search
MAATDLERISNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTL
MNTLFNTTFETEEASHHEECVRLRPQTYDLQESNVHLKLTIVDAVGFGDQINKDDSYRPI
VDYIDTQFENYLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVN
IIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVV
GSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELY
RRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELK
EKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQP
LRKDKDKKN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgacctggaacgcatctcgaacgcagagcctgagccccggagcctgtcc
ctgggtggccatgtgggcttcgacagcctccctgaccagctggtcagcaagtcagtcact
cagggcttcagcttcaacattctctgtgtgggggaaactgggattggcaagtccacacta
atgaacacgctcttcaacacgacctttgagactgaagaagccagtcaccatgaagagtgt
gtacgcctgcggcctcagacctatgacctccaagagagtaacgttcatctcaaactgacc
atcgtggatgctgtgggctttggggatcagatcaataaggatgacagttacaggcccata
gttgattacatcgacacgcagtttgaaaactatctacaggaggagttgaagattcgccgt
tccctctttgactaccatgacacgaggatccacgtttgcctctactttatcacacccacc
gggcactccctgaagtccctggatctggtgaccatgaagaaactagatagcaaggtgaac
ataatccccatcattgccaaggctgacaccatctccaagagcgagctccacaagttcaag
atcaagatcatgggtgagctggtcagcaatggagtccagatctaccagtttcccaccgac
gatgaggctgtcgccgagattaatgcggtcatgaatgcacacttgccttttgccgtggtg
ggcagcacagaggaggtgaaggtggggaacaagctggttcgagcacgacagtacccctgg
ggcgtggtgcaggtggagaacgagaaccactgtgacttcgtgaagttgcgggagatgttg
atccgggtgaacatggaggacctgcgtgagcagacccacagtcggcactacgagctctac
cggcgctgcaagttggaggagatgggcttccaggacagtgatggtgacagccagcccttc
agcctccaagagacgtacgaggcaaagaggaaggagttcctgagcgagctacagaggaag
gaggaagagatgaggcagatgtttgtcaacaaagtgaaggagacagagcttgaattgaag
gagaaggaacgggagctccatgagaagtttgagcacctgaagcggatccaccaggaggag
aagcgcaaggtagaggagaagcgcagggagctggaagaggagaccaacgccttcaactgc
cggaaggcagccatggaggccctgcagtcacaggccttacatgccacttcacagcagcct
ctgaggaaagacaaggacaagaagaattaa

DBGET integrated database retrieval system