KEGG   Rattus norvegicus (rat): 303351
Entry
303351            CDS       T01003                                 

Gene name
Rhot1
Definition
(RefSeq) ras homolog family member T1
  KO
K07870  mitochondrial Rho GTPase 1 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    303351 (Rhot1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    303351 (Rhot1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    303351 (Rhot1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     303351 (Rhot1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    303351 (Rhot1)
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    303351 (Rhot1)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   Miro
    303351 (Rhot1)
SSDB
Motif
Pfam: EF_assoc_2 EF_assoc_1 Ras Roc Arf RsgA_GTPase EF-hand_7 EF-hand_6 EF-hand_1 SRPRB PduV-EutP MMR_HSR1 AAA_22 AAA_16 Rad4 Pox_A32 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 303351
NCBI-ProteinID: NP_001100496
RGD: 1307023
Ensembl: ENSRNOG00000004093
UniProt: A1L1L6
Position
10q25-q26
AA seq 631 aa
MRAGRVRPLRASDMKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVT
PERVPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDK
DSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVL
HPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALE
DVKNVVRKHLSDGVADSGLTLRGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYL
FPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFQVFPYIPWGPDVNN
TVCTNESGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAITVTRDKKI
DLQKKQTQRNVFRCNVIGVKGCGKTGVLQSLLGRNLMRQKKIRDDHKSYYAINTVYVYGQ
EKYLLLHDISESEFLTEAEIVCDVVCLVYDVTNPKSFEYCARIFKQHFMDSRIPCLIVAA
KSDLHEVKQEHSVSPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADL
KSSTFWLRASFGATVFAVVGFAMYRALLKQR
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcgtgcgggccgagtgcggcccctgcgagcctccgacatgaagaaagacgtgcggatc
ctgctggtgggagaacctagagttgggaagacatcactgattatgtctctggtcagtgaa
gaatttccggaagaggttcctcctcgggcagaagaaatcaccattccagctgatgtcacc
cctgaaagagttccaacacacattgttgattattcagaggcagaacagagtgatgaacaa
cttcatcaagaaatatcacaggctaatgtcatctgcatagtttatgctgttaacaacaaa
cattctattgataaggtaacaagccgatggattcctctcataaatgaaagaacagacaaa
gacagcaggctgcctttgatattggttgggaacaaatctgacctggtggagtatagtagt
atggagaccatccttccaattatgaaccaatatacagaaatagaaacctgtgtggagtgt
tcagcaaaaaacctaaagaatatatcagaactgttctattatgcacagaaagctgttctt
catcctacagggcctttgtactgcccagaggagaaagagatgaaaccagcttgtataaaa
gccctcactcgtatatttaaaatatctgaccaagataatgatggcactctgaatgatgct
gagctcaacttctttcagagaatttgtttcaacactcctttagctccccaagctctggaa
gatgtcaagaatgtggttagaaagcacttaagtgacggtgtggctgacagtgggctgaca
ctcagaggttttctctttttacatacactttttatccagagggggaggcatgagaccact
tggactgtgcttcgacgatttggttatgatgatgatctggatctgacgcccgagtactta
ttccccctgctaaaaatacctcctgattgcactactgaactaaatcatcatgcatatttg
tttcttcaaagcacctttgacaaacatgatctggacagagactgtgctttgtcacctgat
gaactcaaagatttatttcaagttttcccttacataccttggggaccagatgtaaataac
acagtttgtacaaatgaaagcggctggataacctaccagggattcctttcccagtggacg
ctcacaacctacttagatgtacagcgttgtctggagtatctgggctatctaggctattcc
atactgacggaacaagagtctcaagcttcagccatcacagtaacaagagataaaaagatt
gacctgcagaaaaaacagactcagagaaatgtgttcagatgtaatgtgattggagtgaaa
ggctgtggaaaaactggagttcttcagtctctccttggaagaaacctaatgaggcagaag
aaaattcgtgatgatcataaatcctattatgcaattaacactgtctatgtatacggacaa
gagaaatacttgttgctacatgatatctcagagtcggagtttcttactgaggctgagatc
gtttgtgatgttgtatgcctggtatatgatgtcaccaatcccaagtcatttgaatactgc
gccaggatttttaagcaacattttatggacagcagaattccctgcttaattgtagctgca
aagtcagacctgcatgaagtcaagcaagaacacagtgtctcacctactgatttctgcagg
aaacacaaaatgcctccgcctcaagccttcacttgtaacactgctgatgcgcccagtaag
gatatctttgttaagctgacaacgatggccatgtacccgcacgtgacacaagctgacctc
aagagctcaacattctggcttcgagcaagctttggtgctactgtctttgcagtcgtgggc
tttgctatgtacagagcactattgaaacagcgatga

DBGET integrated database retrieval system