KEGG   Rattus norvegicus (rat): 304135
Entry
304135            CDS       T01003                                 

Gene name
Adamts5
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif, 5
  KO
K08620  a disintegrin and metalloproteinase with thrombospondin motifs 5 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    304135 (Adamts5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     304135 (Adamts5)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   304135 (Adamts5)
SSDB
Motif
Pfam: ADAM_spacer1 Reprolysin ADAM_CR_2 Pep_M12B_propep Reprolysin_5 Reprolysin_3 TSP1_ADAMTS Reprolysin_2 TSP_1 Reprolysin_4 TSP1_spondin Peptidase_M10 TSP1_CCN DUF3530 CxC6 DUF4953 Astacin DUF1180 Peptidase_M54 Peptidase_M78
Other DBs
NCBI-GeneID: 304135
NCBI-ProteinID: NP_942056
RGD: 735196
Ensembl: ENSRNOG00000057794
UniProt: Q6TY19
Position
11q11
AA seq 928 aa
MLLEWASLLLLLLLLCASCLALAADNPAAAPAQDKTRQPRAAAAAAQPDQRQWEETQERG
HPQPLARQRRSSGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDDTVGAAGGIVTAGG
GLSASSGHRGHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGSWAESER
VYGDGSSRILHVYTREGFSFEALPPRTSCETPASPSGPQESPSVHSSSRRRTELAPQLLD
HSAFSPAGNAGPQTWWRRRRRSISRARQVELLLVADSSMAKMYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLTDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDAA
ILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDD
SKFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDVPRKQILG
PEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPC
GKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNS
GRYCTGKRAIYRSCSVIPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPA
DVCKLTCRAKGTGYYVVFSPKVTDGTECRPYSNSVCVRGRCVRTGCDGIIGSKLQYDKCG
VCGGDNSSCTKIIGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKKTG
EYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPTKA
LDVRYSFFVPKKTTQKVNSVISHSSNKVGLHSPQLQWVTGPWLACSRTCDTGWHTRTVQC
QDGNRKLAKGCILSQRPSAFKQCLLKKC
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgctactcgagtgggcgtccttgctgctgctactgctgctgctgtgcgcgtcctgcctg
gccctggcggctgacaaccctgccgcggcacctgcccaggataaaaccaggcagcctcgg
gctgctgcagcggccgcccagcccgaccagcggcagtgggaggaaacacaggagcggggc
catccgcaacccttggccaggcagcgcaggagcagcgggctggtgcagaatatagaccaa
ctctactctggcggtggcaaagtgggctaccttgtctacgcgggcggccggaggttcctg
ctggacctggagagggatgacacagtgggtgctgctggtggcatcgttactgcaggagga
gggctgagcgcatcctctggccacaggggtcactgcttctacagaggcactgtggacggc
agccctcgatccctagctgtctttgacctctgtgggggtctcgatggcttcttcgcagtc
aagcatgcgcgctacactctgaagccgctcttgcgtgggtcctgggcagagtccgaacga
gtttacggggatgggtcttcacgcatcctgcatgtctacacccgcgagggcttcagcttc
gaggccctgccgccacgcaccagttgcgagactccagcgtccccgtctgggccccaagag
agcccctcggtgcacagtagttctaggcgacgcacagaactggcaccgcagctgctggac
cattcagctttctcgccagctgggaacgcgggacctcagacgtggtggaggcggaggcgc
cgttccatctccagggcccgccaggtggagctcctcttggtggctgactcttccatggcc
aagatgtatgggcggggcctgcagcattacctgctgaccctggcctctattgccaaccgg
ctgtacagtcatgcaagcatcgagaaccacatccgcctggccgtagtgaaagtggtggtg
ctgaccgacaagagtctggaggtgagcaagaacgcggccacgaccctcaagaacttttgc
aaatggcagcaccaacacaaccagctaggtgatgaccatgaggagcactacgatgcagcc
atcctgttcaccagagaggatttatgtgggcatcattcatgtgacaccctgggaatggca
gacgttgggaccatatgttctccggagcgcagctgcgctgtgattgaagatgatggcctc
catgcagctttcactgtggctcacgaaattggacatctacttggcctctctcacgacgat
tccaaattctgtgaagagaattttggttctacagaagacaagcgtttaatgtcttcaatc
cttaccagcattgatgcatccaagccctggtccaaatgcacttcagccacgatcacagaa
tttctggatgacggtcatggtaactgtttactagatgtaccacggaagcagattctgggc
cccgaggaactcccaggacagacctatgatgccacccagcagtgcaacttgacatttggg
cctgaatattctgtgtgccctggcatggatgtctgtgcacggctgtggtgtgctgtggtg
cgccaaggccaaatggtgtgtctgaccaagaagttgcctgccgtggagggcactccctgt
ggtaaaggaagaatctgcctgcaagggaaatgtgtggacaaaactaagaaaaaatattac
tcgacatcaagccatggaaattgggggtcctggggcccctggggtcagtgttctcgctct
tgcgggggaggagtacagtttgcctaccgccattgcaataaccccgcacctcgaaacagt
ggccgctactgcacagggaagagggccatataccgttcctgcagtgtcataccctgccca
cctaacggcaaatctttccgccacgagcagtgtgaagccaaaaatggctatcagtccgat
gcaaaaggagtcaaaacatttgtagaatgggttcccaaatacgcaggtgtcctgccggca
gacgtgtgcaagcttacgtgcagagctaagggcactggctattacgtggtcttttctcca
aaggttacagatgggacagaatgtagaccctacagcaactccgtgtgtgtccgaggaagg
tgcgtgagaacggggtgtgacggcatcatcggctcaaagctacagtatgacaagtgtgga
gtgtgtggaggggataactccagttgtacaaagattatcggaaccttcaataaaaaaagc
aagggttatactgacgttgtgaggatccctgaaggagcaacccacataaaagtccgacag
ttcaaagccaaagaccagactagattcactgcttacttagccctaaagaagaaaactggc
gagtaccttatcaacggcaagtacatgatctccacttcagagaccatcatcgacatcaat
ggtaccgtcatgaactacagtgggtggagtcacagagatgattttttacatgggatgggc
tattcagccacaaaggaaattctgattgtgcagatccttgcaacagacccaactaaagca
ttagacgtccgttacagcttttttgttcccaagaagaccactcaaaaagtgaattccgtc
attagccacagcagcaacaaagtgggactacactccccgcagctacagtgggtgacaggc
ccctggctggcctgctctaggacctgtgacacaggctggcacaccaggaccgtgcagtgc
caggatggaaacaggaaattagctaagggatgcattctctctcagaggccttctgcgttt
aagcaatgtttgctcaagaaatgttag

DBGET integrated database retrieval system