KEGG   Rattus norvegicus (rat): 304918Help
Entry
304918            CDS       T01003                                 

Gene name
Zbtb37, RGD1308731
Definition
(RefSeq) zinc finger and BTB domain containing 37
  KO
K10509  zinc finger and BTB domain-containing protein 37
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    304918 (Zbtb37)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     304918 (Zbtb37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3342 zf-C2H2_2 zf-met zf-C2H2_jaz BTB_2 zf-Di19 Elf1
Motif
Other DBs
NCBI-GeneID: 304918
NCBI-ProteinID: NP_001100661
RGD: 1308731
Ensembl: ENSRNOG00000026907
Vega: OTTRNOG00000000180
UniProt: D3ZGJ3
Position
13q22
AA seq 504 aa AA seqDB search
MTMEKSGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFR
DHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKC
TQILEGIHFKINVAEVEAELSQTRTKHPERPPESHRVTPNLTRSLSPRHNASKGNWRGQV
SAVLDIRELSPPEESTSPQIIEQSSDVEGREPILRINRAGQWYVETGIADQGPQSGDEVR
VLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVAAMVIDTTGHGSVGQESYTLGSSGAKV
ARPTSSEVDRFSPSGSVVSMTERHRARSESPGRMDEPKQLSSQVEESAMMGVSAYVEYLR
EQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY
HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRQAEEG
SPSHEETVAPGESAQGSVSTTGPD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggagaaaagtggaaacatacaactggagatccctgacttcagcaactctgtt
ctgagccatctcaaccagctacgaatgcaaggccgtctctgtgatattgtggtcaatgtg
caaggacaggctttccgggctcacaaagtagtgctggctgccagctccccttatttccgg
gatcacatgtccttgaatgaaatgagtactgtgtccatttctgtcatcaagaaccctact
gtttttgaacagcttctttctttctgttacacagggcggatatgcctgcaactagcagat
atcatcagctacctaacagctgctagttttctgcagatgcagcatattatagacaaatgc
acacagatcctagagggcattcactttaaaattaatgtggctgaggttgaagcagaatta
agtcaaacaaggacaaagcatccagagagacctccagagtctcacagggtaacaccgaat
ctaacccgctcacttagtccacgccataatgcctcaaagggaaactggagaggacaagtc
agtgccgtgctggatatcagagagctcagtcctcccgaggagtccaccagtcctcagata
attgaacagagttctgatgtagagggccgggagcccattctccgaattaacagagcagga
cagtggtatgtggaaacagggatagcagaccaggggccccagagtggtgatgaagtcagg
gttcttggagcagtgcacatcaaaactgaaaatctggaggagtggcttgggccggagaac
cagccttctggagaagatggcagtagtgccgaggaggtcgctgccatggtgattgacacc
acaggccatgggtctgtagggcaagaaagctacactttagggtcttcgggagccaaggta
gctcggccaaccagcagtgaggtcgacagatttagtccctccggcagtgttgtttccatg
acagagagacacagagccagaagtgagtctcctgggagaatggatgagcctaagcagctt
agctcccaggtagaagagtcagcgatgatgggagtaagcgcctatgtggagtatctccga
gaacaagaagtatctgaacgatggttccggtataatccccgcctcacctgcatctactgt
gccaaatctttcaaccaaaagggaagtctggaccgccacatgcgcctgcatatgggaatc
acaccatttgtctgccgcatgtgtgggaaaaagtatacccggaaagatcagctggaatat
cacatccgcaagcacacaggcaacaagccctttcactgtcatgtttgtggcaaaagtttc
cccttccaggccatcttgaatcaacactttcgaaaaaaccaccctggttgtatacctctg
gaagggcctcatagcatttctcctgagactactgtcacatctcggcaagctgaagaaggg
tcaccttcacacgaagaaacagttgctcctggagaatctgctcagggctcagtttctact
actgggccagattga

DBGET integrated database retrieval system