KEGG   Rattus norvegicus (rat): 305471
Entry
305471            CDS       T01003                                 

Gene name
Patz1, Zfp278, Znf278
Definition
(RefSeq) POZ (BTB) and AT hook containing zinc finger 1
  KO
K24383  POZ-AT hook zinc finger protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    305471 (Patz1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    305471 (Patz1)
SSDB
Motif
Pfam: zf-C2H2_assoc3 BTB zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-met zf-Di19 Zn-ribbon_8 zf-C2H2_8 ARS2 zf_C2H2_13 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 305471
NCBI-ProteinID: NP_001100701
RGD: 1308337
Ensembl: ENSRNOG00000018709
UniProt: D3ZX15
Position
14q21
AA seq 641 aa
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGAAAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAAMAANSNGIAGSMQPEEEAARATGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNREGQKCSHQDLIESSDSYGDLSDASDLKTPEKQSANGSF
SCDMAVPKNKMESDGEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSP
FSPQQNMSLLESFGFQIVQSAFASSLVDPEVDQQPIGPEGK
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggagcgggtcaacgacgcttcttgcggtccgtcgggctgctacacctaccaggtgagc
agacacagtacggagatgctgcacaacctgaaccaacaacgcaaaaacggcgggcgcttt
tgcgacgtgctcctacgggtaggcgatgagagcttcccagcgcaccgcgctgtactggct
gcctgcagcgagtactttgagtctgtgttcagcgcccagttaggcgacggcggagctgca
gacggtggtcctgctgatgtgggaggcgcggcggcggctccaggcggcggggctggaggc
agccgcgaactggagatgcacaccatcagttccaaagtgttcggagacatcctggacttc
gcttacacgtcccgaatcgttgtgcgcctagagagcttccccgagctcatgacggccgcc
aagttcctgctgatgaggtcggtcatcgagatctgccaggaagtaatcaaacagtccaac
gtgcagatcctggtgccccctgcccgggctgatatcatgctctttcgccctcctgggact
tctgacttgggcttccctttggacatgaccaacggggcagccatggcagccaacagtaat
ggtattgctggcagtatgcagcccgaggaagaggctgccagggccacaggtgctgctatt
gcgggccaagcttccctgcctgtgttacctggggtggacagattgcccatggtggctgga
cctctatccccccaactactgacttctccattccccaatgtggcatccagtgcacctcct
ctgactggcaagcgaggccggggacgccccaggaaggccaacctgctggactccatgttt
gggtctccagggggcttgagggaagcaggcatccttccatgtggcctgtgcggtaaggtg
ttcactgacgccaaccggctccggcaacatgaggcccagcacggcgtcacaagcctccag
ttgggctatatcgatcttcctcctccaaggctgggtgagaatgggttacccatctccgag
gaccccgacggccccagaaaaaggagccggaccaggaagcaggtggcttgtgagatctgt
ggcaagatctttcgtgacgtataccatctcaaccggcataagctgtcccactctggggag
aagccgtactcgtgcccggtgtgtggtctgcggttcaagagaaaagaccgcatgtcgtac
catgtgaggtcccatgatgggtcagtgggcaaaccgtacatctgccagagctgtgggaaa
ggcttctccaggccagatcacttgaatggacatatcaagcaggtgcacacgtctgagcgc
cctcacaaatgtcagacctgcaatgcctcctttgccactcgagaccgcctgcgctcccac
ctggcctgccatgaagacaaggtgccctgccaggtgtgcggaaagtacttgcgggcagcg
tacatggctgaccacctgaagaagcacagcgaggggcccagcaacttctgcagtatctgt
aaccgagaaggccagaaatgctcacatcaggatctgattgagagctctgattcctatggt
gacctctcagacgccagtgacctgaagactccagagaaacagagtgccaacggctctttc
tcctgcgacatggcagtccctaaaaacaaaatggagtctgacggggagaagaagtaccca
tgccctgaatgtgggagcttcttccgttctaagtcctacttgaacaaacacatccagaag
gtgcatgtccgtgcccttgggggtcccttgggggacctgggccctgcccttggttcacct
ttctctccccagcagaacatgtctcttctcgagtcctttggatttcagattgttcagtca
gcgtttgcatcatctttagtggatcctgaggtggaccagcagcccatagggcctgaaggg
aagtga

DBGET integrated database retrieval system