KEGG   Rattus norvegicus (rat): 307524
Entry
307524            CDS       T01003                                 

Gene name
Wdr33
Definition
(RefSeq) WD repeat domain 33
  KO
K15542  polyadenylation factor subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    307524 (Wdr33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    307524 (Wdr33)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     307524 (Wdr33)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Collagen Ge1_WD40
Other DBs
NCBI-GeneID: 307524
NCBI-ProteinID: NP_001100868
RGD: 1309230
Ensembl: ENSRNOG00000011382
UniProt: F1LT09
Position
18p12
AA seq 1331 aa
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYN
PSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
PVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTAD
HGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFATCSDDGTVRIWDFLRCHEERIL
RGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNG
NWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGLFASGGSDGSLLFWH
VGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLL
PGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNDIEMTIPGLDWGMEE
VMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIPAPNEVLNDRKEDIKLEEKKKTQAE
IEQEMATLQYTNPQLLEQLKIERLAQKQADQIQPPPSSGTPLLGPQPFSGQGPMSQIPQG
FQQPHPSQQMPLVAQMGPPGPQGQFRAPGPQGQMGPQGPPLHQGGGGPQGFMGPQGPQGP
PQGLPRPQDMHGPQGMQRHPGPHGPLGPQGPPGPQGSSGPQGHMGPQGPPGPQGHIGPQG
PPAPQGHMGPQGPPGTQGMQGPPGPRGMQGPPHPHGIQGGPTSQGIQGPLMGLNPRGMQG
PPGPRENQGPAPQGIMIGHPPQEMRGPHPPSGLLGHGPQEMRGPQEMRGMQGPPPQGSML
GPPQELRGPSGSQGQQGPPQGSLGPPPQGGMQGPPGPQGQQNPARGPHPSQGPIPFQQQK
APLLGDGPRAPFNQEGQSTGPPPLIPGLGQQGAQGRIPPLNPGQGPGPNKGDSRGPPNHH
LGPMSERRHEQSGGPEHGPDRGPFRGGQDCRGPPDRRGSHPDFPDDFSRPDDFHPDKRFG
HRLREFEGRGGPLPQEEKWRRGGPGPPFPPDHREFNEGDGRGAARGPPGAWEGRRPGDER
FPRDPDDPRFRGRREESFRRGAPPRHEGRAPPRGRDNFPGPDDFGPEEVFDASDEAARGR
DLRGRGRGTPRGGSRKCLLPTPDEFPRFEGGRKPDSWDGNREPGPGHEHFRDAPRPDHPP
HDGHSPASRERSSSLQGMDMASLPPRKRPWHDGSGTSEHREMEAQGGPSEDRGSKGRGGP
GPSQRVPKSGRSSSLDGDHHDGYHRDEPFGGPPGSSSSSRGGRSGSNWGRGSNMNSGPPR
RGTSRGSGRGR
NT seq 3996 nt   +upstreamnt  +downstreamnt
atggctacagaaattggctctcctccacgatttttccatatgccgaggttccagcaccag
gctccccgacagttgttctataagcggcctgactttgcacagcagcaggcaatgcagcag
ctcacctttgacgggaagcggatgagaaaggccgtgaaccggaaaaccatagactacaac
ccctctgtcattaagtatttggagaataggatatggcaaagagatcagagagatatgcgg
gcaattcagccggatgcaggttattataatgatctggtcccacctataggaatgttgaat
aatcctatgaatgcagtaacaacgaaatttgttaggacatcaacaaacaaagtaaaatgc
ccagtgtttgttgtgaggtggaccccggaaggaagacggttggtcactggagcttctagt
ggggagttcaccttgtggaacgggctgactttcaactttgaaaccatattgcaggctcat
gatagccctgtgagggccatgacttggtcacataatgacatgtggatgttgacagcagat
catggaggatatgtgaaatattggcaatccaacatgaacaacgtcaagatgttccaggca
cataaggaggcgattagagaggccagtttctcacccacggataataaatttgctacatgc
tctgatgacggcactgttagaatctgggattttcttcgttgccatgaggaaagaattctc
cgaggtcatggtgctgatgtgaagtgtgtagattggcatccaaccaaagggttggttgtt
tcaggaagtaaagatagccagcagccaatcaagttctgggaccccaagactgggcagagt
cttgcaacacttcacgcccataaaaacacggtgatggaagtgaaattaaacctcaacggc
aactggctcctcacggcctctcgtgaccatctctgtaagcttttcgatatccgaaacctg
aaagaagagcttcaggtattccgaggtcacaagaaggaagccacagctgtagcctggcat
cctgtccacgaaggactttttgccagcggaggatccgacggctccttgttattctggcac
gttggggtggagaaggaagtaggtgggatggagatggcccacgaagggatgatctggagt
ttggcttggcatcctctgggacatattctctgctcgggctcaaatgaccataccagcaaa
ttctggactcgaaatcggccaggtgacaaaatgcgagatcgatataatctgaacctttta
cctggcatgtcagaagacggagtagagtatgatgacctggaacctaatagcctggcagtg
attccagggatgggaatcccagaacaactgaaactggccatggagcaggagcagatgggg
aaagatgaatcaaatgacattgaaatgacaattccaggcttggattggggaatggaagaa
gtaatgcaaaaggatcagaaaaaagttcctcagaagaaagtcccttatgcaaagcccatt
cctgctcagttccagcaggcctggatgcaaaataaagttccaattcctgctccaaatgag
gtgctgaatgacaggaaagaggatattaagctagaagagaagaaaaaaacacaagcagaa
atcgagcaagaaatggccacgctgcagtataccaacccacagcttttagagcaacttaaa
attgaaaggcttgcccagaagcaggccgatcagatccagcctcctccctcgtctggtact
cctctcctcggacctcagcccttttctggtcaaggcccaatgtctcagatccctcaaggt
tttcagcagcctcacccatctcagcagatgccattggtggctcaaatggggcctccaggt
ccacagggccagttcagagcccctggaccccagggacaaatgggaccacaaggccctcca
ttgcatcaaggaggtggggggccacaaggattcatgggaccacaaggaccccagggccct
ccccagggtctgccacggcctcaggacatgcatggtccacaaggaatgcagaggcaccct
ggacctcatggccctttgggacctcaagggccacccggacctcaaggtagttctggtcct
caaggtcatatgggtcctcagggtccaccaggacctcagggtcacattggcccccaaggc
ccacctgctcctcagggccatatgggcccacagggtcctcctggtactcaaggaatgcag
ggaccacctggtcccagaggaatgcaaggacctcctcatcctcatgggatacagggtggg
ccaacatctcaagggatccagggacctctgatgggactgaatccaagaggaatgcaggga
cccccaggacctcgggagaatcagggtcctgctcctcaagggataatgattggccatcca
cctcaggagatgagaggaccacatcctccaagtggactgctgggacatggccctcaggaa
atgagaggtcctcaggagatgcggggcatgcaggggcctccaccacaggggtcaatgttg
ggccctccccaggaacttcgaggaccctcaggttcacaggggcagcaggggccaccccag
ggctctttgggacctccaccccagggtggcatgcaaggaccccctggacctcagggacaa
cagaacccggcaagagggccacatccatctcaagggccaataccattccagcagcagaaa
gcacctctgctaggtgatgggccccgggcccccttcaatcaggaaggacagagtacaggt
cccccacccttgataccaggcctagggcaacagggagcacaaggccgcattcctcctctg
aaccctggacaaggacccggccctaacaaaggtgactctcgaggccctcccaaccatcac
ctgggccccatgtcagagaggcggcatgagcagagcggtggtcctgagcatggtcctgac
aggggacctttccggggtggccaggactgcaggggtcctcctgacaggcgtggctctcac
cctgatttccctgatgacttcagcagaccagatgacttccatcctgacaagcgctttggc
caccggttacgggaattcgagggacgaggaggacccttaccacaagaagaaaagtggagg
cgagggggccctggacctccctttccacctgatcacagggagttcaatgagggggacggc
cggggtgcagcccgaggccctccaggggcatgggaaggccgcagacctggagacgaacga
ttcccccgggatcctgatgacccacgatttcgagggcgcagagaagaaagctttagaaga
ggtgctcccccaagacacgaaggccgtgctcctccaagaggaagggacaactttcctggt
cctgatgactttggtccagaagaggttttcgatgcttctgatgaagcagcccgaggacga
gatctcagaggtcgaggccgtggcacccctagagggggatccaggaagtgcttactcccc
actcctgatgagtttcctcgctttgaaggaggacggaagccagactcctgggatggaaac
cgagagcccggaccaggtcatgaacactttcgtgatgctccccgtcctgatcatccccct
cacgatggccattcaccagctagcagagagcgctcctcttctctccaaggcatggacatg
gcctccctaccaccccggaagcgcccctggcatgatgggtcgggcacttctgaacacaga
gagatggaggcccaaggaggcccctcggaggaccgaggaagcaaaggccgagggggccca
ggaccttcccagagagttccaaaatccgggcgttccagctctttggacggagaccatcat
gatggataccacagagatgaaccttttggtggccctccaggcagcagctcatcttctcga
gggggccggagtggcagtaactggggtagagggagtaacatgaactctggccctccaagg
agaggcacttcaagaggtagtgggaggggtcggtag

DBGET integrated database retrieval system