KEGG   Rattus norvegicus (rat): 308366
Entry
308366            CDS       T01003                                 

Gene name
Zbtb45, Zfp499, Znf499
Definition
(RefSeq) zinc finger and BTB domain containing 45
  KO
K10516  zinc finger and BTB domain-containing protein 45
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    308366 (Zbtb45)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     308366 (Zbtb45)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_11 Zn-ribbon_8 zf-C2H2_2
Other DBs
NCBI-GeneID: 308366
NCBI-ProteinID: NP_001100948
RGD: 1310920
Ensembl: ENSRNOG00000027459
UniProt: D4A1A3
Position
1q12
AA seq 519 aa
MAATEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQD
KLLLGHSEIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQ
IIARARVPNPPAPAPLPPPVPPPLAPAQLRHRLRHLLAARPPGHPNAAHSRKQRQPARLQ
LPAPPTPIKAEGPDTEPVLTAAPEDRGEEDDDEETDEETDAEEGEGVGGPGEGQAPPAFP
DCAGGFLTAAADSAREDPPASTGITDYGGAGRDFLRGTGVTEDVFPDSYVSAWHEEGSGG
PEGCPVETSAPPDCALAGPHPTGVKTPGPPVALFPFHLGAPGPPAPTPPTPSGPAPAPPP
TFYPTLQPDAAPSAQLGETPAVPAAPAAQATAISGTPVRAPGAPGAEQPAYECSHCRKTF
SSRKNYTKHMFIHSGEKPHQCAVCWRSFSLRDYLLKHMVTHTGVRAFQCAVCAKRFTQKS
SLNVHMRTHRPERAPCPACGKVFSHRALLERHLAAHPAP
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggcagccacagaggcagtgcaccacatccacctacagaacttttcacgctcactactg
gagaccctcaatgggcagaggctaggtggtcacttctgtgatgtgactgtgcgcatccgt
gaggcttctctgcgtgctcaccgctgtgtgctggccgcaggctcacccttctttcaggat
aagctgttgcttggccactcggagattcgtgtgccaccagtggtgcctgcgcagacagtg
cgccagctggtcgagttcctgtacagcggctcgttagtggtggcacaaggcgaagcactg
caggtactcactgcagcatcggtgcttcgcatccagaccgtcattgatgagtgcacacag
atcatcgctcgtgcccgtgtccccaaccccccggcgcctgcgccactgccaccaccggtg
ccccctccactcgcacctgcgcagctgcgccaccgtctgcgccacttgctggccgctcgt
cccccaggtcatcccaacgccgcgcacagccgcaagcagcgccagcccgcgcgtcttcag
ctacctgcaccccccacgcccatcaaggccgaggggcctgataccgagccagtgttgact
gctgcgcctgaagacagaggtgaagaggatgacgatgaggagaccgatgaagaaaccgac
gctgaagaaggtgaaggcgttggcggcccgggtgaaggccaggctccccctgccttcccc
gactgtgcagggggcttccttaccgctgcagctgacagcgctcgagaagatccacctgca
tccactggcatcactgattatggtggtgccggaagagatttccttcgggggactggggtc
actgaagatgtgtttccagatagttatgtgtccgcttggcatgaggaaggcagcggaggt
ccagaaggttgtccggtggaaacgtctgctccacccgactgtgccctggctgggcctcac
ccaaccggtgtaaagacccctggtcccccagtggctctctttccctttcacttgggtgct
cctggtcccccagcgccaacacctcctactccatctgggccagcccctgcacccccaccc
accttctaccccacgctccagccagatgcagcccccagtgctcagctgggagaaacaccg
gctgtgcctgcagcccctgctgctcaggccacagccatctcaggcactcctgtgcgtgcc
cccggtgccccaggggctgagcaacccgcctatgagtgtagccactgccgcaagacgttc
agctctcgaaaaaactacaccaagcacatgttcatccactctggggagaagccacatcag
tgcgctgtgtgctggcgatccttctcgctacgcgactatctgctcaaacatatggtcaca
cacaccggtgtgcgagccttccagtgtgcagtgtgtgccaagcgcttcactcagaagagt
tcactcaacgtgcacatgcgcacacataggcctgaacgtgcgccctgccctgcctgtggc
aaagttttctcacaccgtgcgctgctagagcgacacctggcagctcaccctgcaccttga

DBGET integrated database retrieval system