KEGG   Rattus norvegicus (rat): 309630
Entry
309630            CDS       T01003                                 

Gene name
Zbtb22, Bing1, Zfp297, Znf297
Definition
(RefSeq) zinc finger and BTB domain containing 22
  KO
K10502  zinc finger and BTB domain-containing protein 22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    309630 (Zbtb22)
   04121 Ubiquitin system [BR:rno04121]
    309630 (Zbtb22)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    309630 (Zbtb22)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     309630 (Zbtb22)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_jaz zf-Di19 zf-C2H2_4 DUF5810 Elf1 Rtf2 zf-C2H2_6
Other DBs
NCBI-GeneID: 309630
NCBI-ProteinID: NP_001009172
RGD: 1359627
Ensembl: ENSRNOG00000000476
Vega: OTTRNOG00000001947
UniProt: Q6MGC7
Position
20p12
AA seq 636 aa
MEPSPMSPSGATLPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVS
IRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLASAYTGRLSMA
AADIVNFLTVGSVLQMWHIVDKCTELLREGRSSAATTTVTAVAAPSVSVPCASVPSGSGG
TVAPATVGSVRSHTSSRASENQSPSSSNYFSPRESTDFSSSSQDAFVASAVGSGNRRDGG
PVFPVPVVGSAGTTSGKLLLEADELCDDGGDGRGAAAPGAGLRRPNCLPASAVPQKHWVY
VKRARNCPAPASLVHQDPDLEDEEEEEDLVLTCEDDEDEDLGNGSGVPAGGEPEATLSIS
DVRTLTEPAEKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGGPTPSSYGLTHPPRPLLPL
DVPGNQILVFPSSSSQAPGQPPGNTAEHGAVTLGGASAVGLGIPSGSGGTPGGAGNSDGN
KIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYEC
SVCAKKFMWRDSFMRHRGHCERRHRMGAGGAASVPGPGPGAPTGPALQPKRESSAVGGGS
GDEANSATPPSNRRVWSPPSVHKVEMDFSGGGGAAH
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggagccatctcctatgtcacccagtggggccacactcccactgcctctgtcactggct
ccaccaccactgcctctgccggcagctgcagtggtacacgtgtccttccctgaggtgacc
agtgccctcctggagtccctcaaccagcagcggctccagggtcagctctgcgatgtgtct
atccgcgtgcagggacgggagttccgtgctcacagggccgtcttggctgcctcctctcct
tacttccacgaccaggtcctactcaaaggcatgacttccatctcactgcccagcgtcatg
gacccaggcgcttttgagactgtcctggcctcagcgtacacgggccgcctcagcatggct
gctgcggacattgtcaacttcctcacagtggggtcggtcctccagatgtggcacattgtg
gataagtgcactgaactccttcgggagggtcgatcttcagccgctactaccactgtcact
gctgttgcagccccctctgtctctgtcccttgtgccagtgtcccatcagggagcgggggc
accgttgcccctgccactgtaggctctgtacgttcccatacctccagccgggccagtgag
aatcagtctcccagcagtagcaactacttcagcccccgggagtcgactgatttctcctct
tcctcccaagatgcatttgtggcctcagcagtgggtagtgggaaccgtcgagatggtggc
cccgtgttcccagtccctgtggttggcagtgcgggtaccacctctgggaagttgctgcta
gaggccgatgagctatgtgatgacggtggggatgggagaggggcggcggcccctggggct
gggctccggaggcccaactgcctgcctgccagtgcagtgccacagaaacactgggtgtat
gtgaagcgagctagaaattgccctgcaccagcatcgctggtccaccaagaccccgatcta
gaggatgaggaagaggaggaagatctggtgttgacttgtgaggatgacgaggatgaagac
ctggggaatggctctggggttcctgcagggggagagcccgaggctaccctcagtatcagt
gacgttcggaccttgacggagcctgcagaaaagggggaggaacaggtgaacttctgtgaa
tcctccaatgactttggcccctatgagggtggtggcgctggggcaggacttgatgaccct
ggaggccccaccccttcctcctatggcctcacccaccctccacgaccccttcttccattg
gatgtgccaggcaaccagatcttggttttcccatcctcctcctcgcaggctccaggccag
ccaccagggaacacagcagaacacggggcagtgaccctagggggtgcctctgcggtgggt
ctgggcataccaagtggctctggggggacccccggaggggcaggcaacagcgacgggaat
aagatctttctttgccactgtgggaaggctttctcacataagagtatgcgggaccggcac
gtgaatatgcatctcaacctgcgaccctttgactgccccgtgtgcaacaagaagttcaag
atgaaacaccacctgaccgagcacatgaagacgcacacaggcctcaagccctacgaatgc
agtgtctgcgccaagaagttcatgtggcgggacagtttcatgcgtcaccggggtcactgt
gagcgccggcaccggatgggcgcgggcggggccgcatcggtacctggacctggaccgggg
gcacccacagggccagcactgcaacccaagagggagtcctccgcagtgggtgggggcagt
ggcgatgaggcgaattcggccacacccccgtctaataggcgtgtctggtcaccacccagc
gtgcacaaagtcgagatggatttcagtgggggtggaggagcagcacactga

DBGET integrated database retrieval system