KEGG   Rattus norvegicus (rat): 311567
Entry
311567            CDS       T01003                                 

Gene name
Itch
Definition
(RefSeq) E3 ubiquitin-protein ligase Itchy homolog
  KO
K05632  E3 ubiquitin-protein ligase Itchy [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    311567 (Itch)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    311567 (Itch)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311567 (Itch)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    311567 (Itch)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311567 (Itch)
   04121 Ubiquitin system [BR:rno04121]
    311567 (Itch)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     311567 (Itch)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    311567 (Itch)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   311567 (Itch)
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 311567
NCBI-ProteinID: NP_001005887
RGD: 1359556
Ensembl: ENSRNOG00000059043
UniProt: Q5YB86
Position
3
AA seq 854 aa
MGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLT
VIVTPMSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLEEVVMTLQLVGDKEPTE
TMGDLSVCLDGLQVEAEVVTNGETSCSEGATQNDAGCRPKDETRVSTNGSEDPEVAASGE
NKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSTNSDSDGSSTGSLPPT
NTNVNSSASEGAASGLIIPRTISGGSGPRPLNTVSQAPLPPGWEQRVDQHGRAYYVDHVE
KRTTRDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQG
AMQQFNQRFIFGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDP
RSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSALDNGPQIAYVRDFK
AKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDY
GGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMAL
FHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDK
EILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQY
LQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIVWFWQFVKEIDNEKRMRLLQ
FVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEK
LLFAIEETEGFGQE
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgggtagtctgaccatgaaatctcaacttcagattactgtcatctcagccaaacttaaa
gaaaataaaaagaattggtttggaccaagtccttatgtagaagtcacagtagatgggcag
tcaaagaagacagaaaaatgcaacaatacaaacagccccaagtggaagcagcccctcaca
gttatcgttacccctatgagtaaattatgttttcgtgtgtggagtcaccagaccctgaaa
tctgatgttttattgggaactgctggattagatatttatgaaacattaaagtcaaacaat
atgaaacttgaggaagtagttatgactttgcagcttgtaggtgacaaagagccaacagag
acaatgggagatttgtcagtttgtcttgatgggctgcaagtagaagctgaagttgttact
aatggtgaaacttcatgctcagagggtgctacacagaatgacgctggctgcagacccaaa
gatgaaacaagagtgagcacaaatggatcagaggaccctgaggttgcagcctcgggggag
aacaagagggccaatgggaacaattctccatccctttcaaatggtggttttaagccttct
agacctcctagaccttcaagaccacctccacccaccccacgaagaccagcttctgtcaat
ggctcaccatccacgaactctgacagcgatggatctagcacaggctctttgccacccaca
aatacaaatgtaaattcaagtgcatcggaaggagcagcatctgggttaataattcctcgt
accatctctgggggctcaggccctaggccgctgaatactgtcagtcaagctcccctccca
cctgggtgggagcagagagtagatcagcatgggcgtgcttactatgtagaccatgttgaa
aagcgaacaacacgggatagaccggaacctctacctcctggctgggaacggcgtgtggac
aatatgggacgtatttattatgttgaccatttcacgagaaccacaacatggcagaggccg
accttggaatctgtccggaactatgagcagtggcagctccagcgtagtcaacttcaggga
gcaatgcagcagtttaaccagagattcatctttgggaatcaagatttgtttgctacatca
caaaacaaagagtttgatccccttggtcctttgccccctggatgggagaagagaactgat
agcaacggcagagtgtattttgtcaaccacaacactcggattacacagtgggaagacccc
agaagccaaggtcagttaaatgaaaagcccttaccagaaggctgggaaatgcgattcaca
gtggatggaattccatattttgtggaccacaatagaagagcaactacctacatagatcca
cgcacaggaaagtcagccttagacaacggaccccagatagcctatgttcgggacttcaag
gcaaaagttcagtatttccggttctggtgtcagcaactggccatgccacagcatataaag
atcacagtgacaagaaaaacattgtttgaggattcctttcaacagatcatgagcttcagt
ccgcaagatctgagaagacgtttgtgggtgattttcccaggagaagaaggtttagattat
ggaggtgtagcaagagaatggttctttcttttgtcacatgaagtgttgaacccaatgtat
tgcctgtttgaatatgcagggaaggataactactgcctgcagataaaccccgcttcttat
atcaacccagaccacctgaaatacttccgttttattggcagatttattgccatggctcta
ttccatgggaaattcatagataccggattttctttaccattctataaacgtatcttgaat
aaaccagtgggacttaaggatttagaatctatcgatccagaattttacaattctctcatc
tgggttaaagaaaacaatatcgaggaatgtggtttggaaatgtacttctcagttgataaa
gaaattctgggtgaaattaagagtcatgatttgaaacccaatggtggcaatattctggtg
acagaagaaaataaggaagagtacatcaggatggtcgctgagtggaggttgtctcgggga
gttgaagagcagacacaagctttctttgagggctttaatgaaattcttcctcagcaatat
ttgcaatattttgatgcgaaggaattagaggtccttttgtgtgggatgcaggagatcgat
ttgaatgactggcagagacacgccatctaccgtcactataccaggacgagcaagcagatc
gtgtggttttggcagtttgttaaagaaattgataacgagaagaggatgcgacttctgcag
tttgttaccggaacctgccgattgccagtgggaggatttgctgacctcatggggagtaat
ggaccacagaagttctgcatcgaaaaagttggcaaagaaaattggttacccagaagccat
acttgttttaaccgcctggacctcccaccctacaagagctatgagcaactgaaggaaaag
ctgttatttgccattgaagaaactgaaggatttggacaagagtaa

DBGET integrated database retrieval system