KEGG   Rattus norvegicus (rat): 311844
Entry
311844            CDS       T01003                                 

Gene name
Kyat1, Ccbl1, Gtk, Kat1, KatI
Definition
(RefSeq) kynurenine aminotransferase 1
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00380  Tryptophan metabolism
rno00450  Selenocompound metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    311844 (Kyat1)
   00380 Tryptophan metabolism
    311844 (Kyat1)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    311844 (Kyat1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    311844 (Kyat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    311844 (Kyat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     311844 (Kyat1)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     311844 (Kyat1)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     311844 (Kyat1)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class I
   311844 (Kyat1)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Herpes_gI Aminotran_5
Other DBs
NCBI-GeneID: 311844
NCBI-ProteinID: NP_001013182
RGD: 1306912
Ensembl: ENSRNOG00000016097
UniProt: Q08415
Position
3p12
AA seq 457 aa
MFRSAAALSVHLMWPLWGRKAGASLTRCLHQSLTMTKRLQARRLDGIDQNLWVEFGKLTK
EYDVVNLGQGFPDFSPPDFATQAFQQATSGNFMLNQYTRAFGYPPLTNVLASFFGKLLGQ
EMDPLTNVLVTVGAYGALFTAFQALVDEGDEVIIMEPAFDCYEPMTMMAGGCPVFVTLKP
SPAPKGKLGASNDWQLDPAELASKFTPRTKILVLNTPNNPLGKVFSRMELELVANLCQQH
DVVCISDEVYQWLVYDGHQHVSIASLPGMWDRTLTIGSAGKSFSATGWKVGWVMGPDNIM
KHLRTVHQNSIFHCPTQAQAAVAQCFEREQQHFGQPSSYFLQLPQAMELNRDHMIRSLQS
VGLKLWISQGSYFLIADISDFKSKMPDLPGAEDEPYDRRFAKWMIKNMGLVGIPVSTFFS
RPHQKDFDHYIRFCFVKDKATLQAMDERLRKWKELQP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgttcaggagtgcagcagccctctcggtgcacctgatgtggccactctggggaaggaaa
gctggagcctcactcacccggtgcttgcaccagtctctcaccatgaccaaacggctgcag
gctcggaggctggacgggattgatcaaaacctctgggtggagtttggcaaactgaccaag
gagtatgacgtcgtgaacttgggtcagggcttccctgacttctcgcctccggactttgca
acgcaagcttttcagcaggctaccagtgggaacttcatgctcaaccagtacaccagggca
tttggttacccaccactgacaaacgtcctggcaagtttctttggcaagctgctgggacag
gagatggacccactcacgaatgtgctggtgacagtgggtgcctatggggccttgttcaca
gcctttcaggccctggtggatgaaggagatgaggtcatcatcatggaacctgcttttgac
tgttatgaacccatgacaatgatggctggaggttgccctgtgttcgtgactctgaagccg
agccctgctcctaaggggaaactgggagccagcaatgattggcaactggatcctgcagaa
ctggccagcaagttcacacctcgcaccaagatcctggtcctcaacacacccaacaaccct
ttaggaaaggtattctctaggatggagctggagctggtggctaatctgtgccagcagcac
gatgtcgtgtgcatctctgatgaggtctaccagtggctggtctatgacgggcaccagcac
gtcagcatcgccagcctccctggcatgtgggatcggaccctgaccatcggcagtgcaggc
aaaagcttcagtgccactggctggaaggtgggctgggtcatgggtccagataacatcatg
aagcacctgaggacagtgcaccagaattctatcttccactgccccacccaggcccaggct
gcagtagcccagtgctttgagcgggagcagcaacactttggacaacccagcagctacttt
ttgcagctgccacaggccatggagctgaaccgagaccacatgatccgtagcctgcagtca
gtgggcctcaagctctggatctcccaggggagctacttcctcattgcagacatctcagac
ttcaagagcaagatgcctgacctgcccggagctgaggatgagccttatgacagacgcttt
gccaagtggatgatcaaaaacatgggcttggtgggcatccctgtctccacattcttcagt
cggccccatcagaaggactttgaccactacatccgattctgttttgtcaaggacaaggcc
acactccaggccatggatgagagactgcgcaagtggaaagagctccaaccctga

DBGET integrated database retrieval system