KEGG   Rattus norvegicus (rat): 312566
Entry
312566            CDS       T01003                                 

Gene name
Adamts9
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif, 9
  KO
K08624  a disintegrin and metalloproteinase with thrombospondin motifs 9 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    312566 (Adamts9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     312566 (Adamts9)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   312566 (Adamts9)
SSDB
Motif
Pfam: TSP1_ADAMTS GON TSP_1 Pep_M12B_propep ADAM_spacer1 TSP1_spondin Reprolysin TSP1_CCN Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4
Other DBs
NCBI-GeneID: 312566
NCBI-ProteinID: NP_001101347
RGD: 1306889
Ensembl: ENSRNOG00000023257
UniProt: D3ZMB0
Position
4q34
AA seq 1880 aa
MQLVSWATLLTLLVPDLVEMRSPDSAAAVRKDRLHPRQVKLLESLSEYEIASPIRVNPLG
EPFPTNVHFKRRRRSINSASDPWPAFASSSSSSSTSSQEHYRLKAFGQQFLFNLTAHTGF
IAPLFTVTLLGEPGVNQSKLYSEEEMELRHCFYKGHVNTKSEHTAVISLCSGMMGTFRSH
DGDYFIEPLLSVDEQEDEEEQNKPHVIYRRNNPQREPSTGKHACDTSELKNSYSKDKRKT
RLRKRRKRNSLADDVAALKRGMATKAFSGYNNRTNGTRDRRNHKRTKRFLSYPRFVEVMV
VADHRMVLYHGSNLQHYILTLMSIVASIYKDSSIGNLINIVIVNLVVIHNEQEGPSINFN
AQTTLKNFCQWQHSKNHLGGIQHDTAVLVTREDICRAQDKCDTLGLAELGTICDPYRSCS
ISEDSGLSTAFTIAHELGHVFNMPHDDSNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCS
RKYITEFLDTGYGECLLNEPQSRTYPLPSQLPGLLYNVNKQCELIFGPGSQVCPYMHCKF
GFCVPKEMEGPAIDGSWGSWSHFGACSRTCGGGIRTAIRECNRPEPKNGGRYCVGRRMKF
KSCNTEPCPKHKRDFREEQCAYFDGKHFNINGLLPSVRWVPKYSGILMKDRCKLFCRVAG
NTAYYQLRDRVIDGTPCGQDTNDICVQGLCRQAGCDHILNSKARKDKCGICGGDNSSCKT
VAGTFNTVHYGYNTVVRIPAGATSLDVRQHSFSGKSEDDNYLALSNSRGEFLLNGDFVVS
MSKREVRVGSAMIEYSGSDNVVERLNCSDRIEEELLLQVLSVGKLYNPDVRYSFNIPIED
RSQQFYWNSHGPWQACSKPCQGERRRKLVCTRESDQLTVSDQRCDRLPQPGPVTEACGTD
CDLRWHIASKSECSAQCGLGYRTLDIHCAKYSRVDGKTEKVDDSFCGSQPRPSNQEKCSG
ECSTGGWRYSAWTECSKSCDGGTQRRRAICVNTRNDVLDDSKCAQQEKVIVQRCNEFSCP
HWKTGEWSECLVTCGKGHKHRQVWCQFGEDRLSDRMCDPEAKPEPMQMCQQPECAAWQAG
PWGQCSVTCGQGYQLRAVKCIMGTYMSVVDDNDCNAATRPTDTQDCELSSCHPSILTLEP
RRHVHGVPRTQWRFGSWTPCSATCGKGTRMRYVSCRDEDGSVADESACATLPKPVAKEEC
SVTPCGQWKALDWSSCSMTCGQGKATRQVVCVNYSDHVIDQSECDPDYIPETDQDCSMSP
CPQWTGSAYPFQNEDFRPRSDSPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDE
NGYTATDCVERIKPDEQRACESGPCPQWAYGSWGECTKLCGGGMRTRLVVCQRANGDRFP
DLSCEVLDKPPDREQCNTHACPQDAAWSTGPWSSCSVSCGRGHKHRNVYCLAKDGSHLES
DYCKHLPKPHGHRRCRGGRCPRWKAGAWSQCSVSCGQGVQQRHVGCQIGTHKTARESECS
SYSRPESERVCQASPCPLYTWRAEQWQQCTKTCGEGSRYRQVVCVAEDQSEVHSAHCDSD
QRPPDRESCSLQPCEYVWITGEWSECSVTCGKGYRQRLVSCSEIYTGKENYEYSYQTTVN
CPGTQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCGMGVMHRSVQCLTNEDQPSHLCPTD
IKPEERKTCHNVYNCELPQNCKEVKKLNSASVDGEYFLAVRGKPLKVFCAGMHSDYPKEY
VTLAHGDSENFSEVYGHRLHNPTECPYNGSRRDDCHCRKDYTAAGFSSFQKIRIDLTSMQ
IITTDLEFARTSEGHPVPFATAGDCYSAAKCPQGRFSINLYGTGLSLTESARWTSQGNYA
VSDIKKSPVRLCIAWGMVLV
NT seq 5643 nt   +upstreamnt  +downstreamnt
atgcagttagtatcctgggccacactgctaacgctcctggtgccggacctggttgagatg
aggagccccgactccgcggcggccgtgcgcaaggacaggctgcacccgaggcaagtgaaa
ttattagagagtctgagcgaatatgagatcgcgtctcccatccgagtgaaccccctcggg
gaaccctttcccacgaacgtgcacttcaaaagaaggcgacgaagcattaactctgcctct
gacccctggcctgccttcgcctcctcctcctcgtcttcctctacctcttcccaggagcat
taccgcctcaaagccttcggccagcagtttctatttaatctcaccgcccataccggattt
atcgctccactgttcactgtcaccctccttggagagccaggggtgaaccagtccaaactg
tattccgaggaagaaatggaacttaggcactgtttctacaaaggccatgtcaataccaag
tctgagcacactgcggtcatcagcctgtgctccggaatgatgggcacgttccggtctcac
gatggagattattttattgaaccactgctgtccgtggatgagcaagaggatgaggaggaa
cagaacaaaccccacgtcatttataggcgcaacaaccctcagagggaaccctccacagga
aagcatgcctgtgacacctcagaactcaaaaatagctacagtaaagacaagaggaaaacc
agacttcgaaaacggagaaagaggaatagcctggctgacgacgtggcagcgttaaagaga
ggcatggcaactaaggcgttctctggttataacaacaggacaaatggcacgagggacaga
aggaaccacaaaagaaccaaacgctttctgtcctatccacggtttgtagaagtgatggta
gtggctgaccacaggatggttttataccatggatcaaaccttcagcattatattttaacc
ttaatgtcaattgtagcttctatctataaagactcaagtattggaaatttaattaatatt
gttattgtgaacttagttgtgattcataatgaacaggaaggaccttccataaatttcaat
gcccagacaacattaaagaacttttgccagtggcagcattccaagaaccacttgggtggg
attcagcatgacacagctgttctagtcacaagggaggatatctgcagagctcaggacaaa
tgcgacaccttaggtcttgccgaattgggaaccatctgcgacccctacagaagctgttcc
attagtgaagacagtggcttgagcacagcgttcaccatagcccacgagctgggccatgtg
tttaatatgcctcatgatgacagcaataaatgcaaagaagaaggcgttaagagcccccag
catgtcatggcgccaacactgaacttctacaccaacccctggatgtggtccaagtgcagt
cggaagtacatcaccgagttcttagacactgggtatggagagtgcttgttaaatgaacct
caatccaggacctatcctttgccttcccaactgcccggccttctctacaacgtgaataaa
caatgtgaactgatttttggaccaggctctcaagtgtgcccatatatgcactgcaagttt
ggattctgtgttcccaaagaaatggagggccctgcaattgatggatcctggggaagttgg
agtcactttggggcctgctcaagaacatgtggaggaggcatcagaacagccatcagagag
tgcaacagaccagagccaaaaaatggtgggaggtactgtgtagggaggagaatgaagttc
aaatcctgcaacaccgagccctgcccgaagcacaagcgagacttccgtgaggagcagtgt
gcttactttgacggcaagcacttcaacatcaatggtctgctgcccagtgtacgctgggtc
cctaagtacagtggaattttgatgaaggaccgatgcaagttgttctgcagagtggcagga
aacacagcctactaccagcttcgagacagagtgattgacggaaccccctgtggccaggac
acaaatgacatctgtgtccaaggcctttgccggcaagctggatgtgatcatattttaaac
tcaaaggcccggaaagataaatgtgggatttgtggtggcgataattcttcatgcaaaaca
gtggcgggaacatttaacacggtccattatggttacaatactgttgtccgaattccagcc
ggtgctaccagccttgatgtgcgacagcacagcttctcagggaagtccgaggatgacaac
tacctagctttatcaaacagtagaggtgaattcctgctcaatggagactttgttgtctcc
atgtccaaaagggaggtccgcgtggggagtgccatgattgagtacagtggatccgacaat
gtggtggaaagactgaactgttcagaccgtatcgaggaagaacttctcctacaggtattg
tcagtggggaagttgtacaacccagatgtgcggtattcattcaatattccaattgaggac
agatctcaacagttttactggaacagtcatgggccgtggcaagcatgcagcaaaccctgc
caaggggagcggagacgaaaacttgtttgcaccagggagtctgatcaacttaccgtttct
gatcaaagatgtgaccggctgccccagccaggacctgtcactgaagcgtgtggtacagac
tgtgatttgaggtggcacatcgccagcaagagcgaatgcagtgcccagtgtggtctgggt
tatcgtactttagatatccactgtgccaaatacagcagggtggatgggaagacggagaag
gtagatgacagtttttgtggcagtcaacccagaccaagcaaccaggagaaatgctcagga
gagtgcagcacaggcggatggcgctattctgcctggacagaatgttctaaaagctgtgat
ggtggtacccagagaagaagagcaatttgcgtcaacacccgcaatgatgtcctggatgac
agcaaatgcgcacagcaggagaaagtcatcgtacagagatgcaatgagttctcctgtcct
cattggaaaacaggagagtggtcagagtgcttggtcacctgtggaaaaggacataagcac
cgccaggtctggtgtcagtttggtgaagatcgattaagcgatagaatgtgtgaccccgag
gccaagccggagcccatgcagatgtgtcagcagccagagtgcgcagcctggcaggcgggt
ccctggggacagtgcagtgtcacttgtggacagggataccagctaagagcagtgaagtgc
atcatggggacttacatgtcagtggtcgatgacaatgactgtaatgcagccactaggcca
accgatacccaggactgtgaactatcgtcctgtcacccttccatactcaccctggaacca
aggagacatgtacacggtgtacccagaacccagtggcgatttgggtcttggactccatgc
tcagccacttgtggaaaaggtacccggatgagatatgttagctgccgggacgaggacggt
tctgtggctgatgagagtgcctgtgctaccttgcctaaaccagtagccaaagaagagtgt
tccgtgacaccctgtggacagtggaaggctctagactggagctcttgttccatgacttgt
gggcaaggtaaggcgacccgacaagtggtgtgtgtcaactacagtgaccacgtgatcgat
cagagtgagtgtgacccagattatatcccagagactgaccaggactgctctatgtcacca
tgccctcaatggactggctcggcttacccatttcaaaacgaggatttccgtcccaggagt
gacagccctagccgtacacacgtgcttggaggaaaccagtggagaactggcccctgggga
gcctgttctagtacctgtgccggaggctcccagaggcgagttgtggtgtgtcaggacgaa
aacggatacacagccaccgactgcgtagagagaatcaagcctgatgagcaaagagcctgt
gaatctggcccgtgtccccagtgggcttacggcagctggggagagtgtaccaagctgtgt
ggtggaggcatgcggacaagactggtggtctgtcagcgggccaatggtgaccgcttccca
gatttgagttgtgaagtcctcgacaaacctcctgaccgtgaacagtgcaacacacacgct
tgcccacaagatgctgcgtggagtactggcccgtggagctcgtgttctgtctcttgtggt
cgagggcataaacatcgaaatgtttactgcttggcaaaagatggaagccatttagagagt
gattactgtaagcaccttcctaagccacatgggcacagaaggtgccgaggaggacggtgt
ccccgatggaaggctggcgcatggagtcagtgctctgtgtcctgtggccaaggagtgcag
cagaggcatgtgggctgtcagatcgggacacacaaaacagccagagagagtgagtgcagt
tcatacagcagaccagagtcggagcgtgtctgccaagcctcaccatgtcctctctacact
tggagggcagagcaatggcaacaatgcaccaagacgtgtggagaaggttcccggtaccgg
caggtggtatgtgtggcagaggaccaaagtgaagtgcacagtgcacattgtgactcagac
caacggcctccagaccgtgagagctgcagcctacagccctgcgagtacgtgtggatcaca
ggagaatggtctgagtgctcagtgacctgtggaaagggctacaggcaaaggctggtctcc
tgcagtgagatttatacgggcaaggagaattacgaatacagctaccaaaccacagtgaac
tgcccaggcacacagcctcccagcgtccatccctgctacctgagggactgtcctgtctcg
gccacctggagagttggtaactggggcagttgctcagtgtcctgcggcatgggagtgatg
catagatctgtgcagtgtttaactaacgaagatcaacccagccacttatgtcccactgat
ataaagccagaagaaagaaaaacctgtcacaatgtttataactgtgagttaccccagaac
tgcaaggaggtaaaaaaactcaatagcgccagcgttgatggggaatatttcctggctgtc
aggggaaagccactaaaggtattctgtgcagggatgcattctgactatcccaaggagtac
gtgacgctggcccatggtgactcggagaacttctccgaagtttacgggcacaggttgcac
aacccaacagaatgtccctataacgggagccgacgggatgactgccattgccggaaggat
tacacagctgctggcttctccagtttccagaaaatccgaattgacctgaccagcatgcag
atcataaccactgacttagagtttgcaaggacaagtgaagggcatcctgttccttttgcc
accgctggggactgctacagtgctgccaaatgcccacagggccgttttagcatcaacctt
tatgggaccgggctgtccttaaccgagtctgccagatggacatcacaagggaattatgcc
gtttcagacatcaagaagtctccggtaaggctctgtattgcttgggggatggttcttgtt
taa

DBGET integrated database retrieval system