KEGG   Rattus norvegicus (rat): 312705
Entry
312705            CDS       T01003                                 

Gene name
C1r
Definition
(RefSeq) complement C1r subcomponent precursor
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    312705 (C1r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    312705 (C1r)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    312705 (C1r)
  09171 Infectious disease: bacterial
   05133 Pertussis
    312705 (C1r)
   05150 Staphylococcus aureus infection
    312705 (C1r)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    312705 (C1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    312705 (C1r)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312705 (C1r)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     312705 (C1r)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   312705 (C1r)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    312705 (C1r)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 312705
NCBI-ProteinID: NP_001128027
RGD: 1309091
Ensembl: ENSRNOG00000011796
UniProt: B5DEH7
Position
4
AA seq 707 aa
MRLIPLLLVTLFCGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPTGYRVKLVF
WQFDVEPSEGCFYDYVKISADKKTLGRFCGQQDSPQGNPPGRKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECTSQPNSVEEGLQPRCQHLCHNYVGGYFCSCRPGY
ELQKDRQSCQAECSSGLYTEPSGYISSLEYPKPYPPDLRCNYSIRVERGLTVHLKFLDPF
EIDDHQQVHCPYDQLQIYANGKNLGEFCGTQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKALDEFTIIQDPQPQYQFRDYFIVTCKQGYQLMEGSQALLSFTAVCQH
DGTWHRAMPRCKIKDCGQPRSLSNGDFRYLTTRGVNTYEARIQYYCHDPYYKMMTRAGSS
ESVRGIYTCTPQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKQRIIGGQKANPGNFPWQAF
TNIHGRGGGALLGDRWILTAAHTIYPKEHNKENNVNVSKDVFLGHTNVEEIKKLGHHPVR
RVIIHPDYRQDEPNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDKDLMGYVSGFGI
TEDKIAFNLRFVRLPIADREACQRWLRTKNSNDVFSQNMFCSGDPTLKHDACQGDSGGVF
AVRDRSRDIWVATGIVSWGIGCGEGYGFYTKLLNYVDWIKKEIGDEN
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgcgtctcatccccctcctcctggtgaccctgttctgtggggtggagggctccatctac
ctccctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagt
gacttggagacgaccaccgtgatcactgtccccacggggtacagggtgaagctggtcttc
tggcagtttgatgtggagccttctgaaggctgtttctatgactacgtcaagatttctgct
gataagaaaactctggggaggttctgtgggcagcaggattctcctcagggcaacccccca
ggaaggaaggaattcatgtcccaaggaaacaagatgctgctgacctttcacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggct
gtggaccttgatgaatgtacgtcccagcccaactcagtggaggagggtttgcagccccga
tgccaacacctgtgccacaactatgttggaggttacttctgttcctgccgtcctggctac
gagcttcagaaagacaggcaatcctgccaggccgagtgcagcagtgggctctacacggag
ccctcgggctacatctccagcctcgagtacccgaagccctatccacccgatctgcgctgt
aactacagcatccgggtagagaggggcctcactgtgcacctcaagttcctggatcctttt
gaaattgatgaccaccagcaagtacactgcccctatgaccagctccagatctacgctaat
gggaagaacttgggtgaattctgtggaacgcaaaggcctccagaccttgacaccagcagc
aacgccgtggatctgctgttcttcacggatgagtccggggacagccgaggctggaagctt
cgctacaccactgaaatcatcaagtgcccccaacccaaggccctggatgagttcaccatc
atccaggatccacagcctcagtaccagttccgggattacttcattgtcacctgcaaacaa
ggctaccagctcatggagggaagtcaggcgctgctctccttcacggctgtttgccagcat
gatggcacgtggcaccgtgccatgcccaggtgcaagatcaaggactgtggacagccccgc
agcctgtctaatggggacttccgctacctcaccacaagaggcgtgaacacctatgaagcc
aggatccagtattactgccatgacccatattacaagatgatgaccagagctggcagcagc
gagtccgtacgagggatatatacctgcacaccccaaggcatttggaagaacgaagaggaa
ggagagaaaatgccccggtgtctgccagtatgtgggaagcctgtcaaccccgtgacacag
aagcagcgcatcatcggagggcagaaagccaatccgggcaacttcccctggcaggcattc
accaatatccacgggcgagggggcggggccctgcttggagaccgctggatcctcacggca
gcccacaccatctaccccaaggaacacaacaaagaaaacaacgtcaacgtcagtaaagat
gttttcctgggccacacaaacgtggaagagatcaaaaaactgggacatcaccctgtccgt
cgggtcatcatacacccagactaccgccaagatgagcctaacaattttgaaggagacatt
gccctactggagctggaaaacagtgtcacactgggtcccaacctcctccccatctgtctc
ccagacaatgagaccttctatgacaaagaccttatgggttatgtcagcggcttcgggata
acagaagataaaatagcttttaatctcaggtttgtccgtctgcccatagccgatcgagag
gcatgccagaggtggctccggacgaaaaacagtaatgatgtattttctcaaaatatgttc
tgttctggggacccaactctcaagcatgacgcctgccagggggacagtgggggtgttttt
gcagtcagggaccgcagtcgtgatatctgggtggctacaggcatcgtatcctggggcatt
gggtgtggtgagggatacggcttttacaccaagttactgaattatgttgactggatcaag
aaagagattggagatgaaaactga

DBGET integrated database retrieval system