KEGG   Rattus norvegicus (rat): 313121Help
Entry
313121            CDS       T01003                                 

Gene name
Map3k7, Tak1
Definition
(RefSeq) mitogen activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04520  Adherens junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04660  T cell receptor signaling pathway
rno04668  TNF signaling pathway
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    313121 (Map3k7)
   04310 Wnt signaling pathway
    313121 (Map3k7)
   04064 NF-kappa B signaling pathway
    313121 (Map3k7)
   04668 TNF signaling pathway
    313121 (Map3k7)
   04152 AMPK signaling pathway
    313121 (Map3k7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    313121 (Map3k7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    313121 (Map3k7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    313121 (Map3k7)
   04621 NOD-like receptor signaling pathway
    313121 (Map3k7)
   04622 RIG-I-like receptor signaling pathway
    313121 (Map3k7)
   04660 T cell receptor signaling pathway
    313121 (Map3k7)
   04657 IL-17 signaling pathway
    313121 (Map3k7)
  09158 Development
   04380 Osteoclast differentiation
    313121 (Map3k7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    313121 (Map3k7)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    313121 (Map3k7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    313121 (Map3k7)
   05162 Measles
    313121 (Map3k7)
   05161 Hepatitis B
    313121 (Map3k7)
   05168 Herpes simplex virus 1 infection
    313121 (Map3k7)
   05169 Epstein-Barr virus infection
    313121 (Map3k7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    313121 (Map3k7)
   05140 Leishmaniasis
    313121 (Map3k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    313121 (Map3k7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     313121 (Map3k7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  MLK family
   313121 (Map3k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 313121
NCBI-ProteinID: NP_001101390
RGD: 1309438
Ensembl: ENSRNOG00000005724
UniProt: P0C8E4
Position
5q21
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SDSGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATTAYTKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSLP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcatccgccgcctcgtcctcctcctcgtcttctgccagtgagatgatcgaa
gcgccatcgcaggtccttaacttcgaagagatcgactacaaggagatcgaggtggaagag
gttgttgggagaggagcttttggagtggtttgcaaagctaagtggagagcaaaagatgtt
gcaattaaacagattgaaagtgaatctgagaggaaggctttcatcgtggagctccggcag
ttgtcccgtgtgaaccatcctaatattgtaaagttgtatggagcctgcttgaatccagtc
tgtcttgtgatggagtatgctgaaggaggctcgttgtataatgtgctgcacggtgctgaa
ccattgccttattacactgctgctcatgccatgagctggtgtctacagtgttcccaagga
gtggcctacctgcacagcatgcagcccaaagctctcattcatagggacctcaagcctcca
aacttgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgt
gacatccagacacacatgaccaataataaagggagtgctgcttggatggcacccgaagtg
ttcgaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctttgg
gaggtgataacacgccggaaaccctttgatgagatcggtggcccagctttcagaatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaacttgcctaagcccattgag
agcttgatgacccgctgttggtctaaggacccttctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagctgatgagccgttacagtac
ccctgtcagtactctgatgaagggcagagcaactcagccaccagcacaggctcatttatg
gacatcgcttctacaaataccagtaataaaagtgacacaaatatggaacaagtccctgcc
acaaacgacactattaaacgcttggagtcaaaactgttgaaaaaccaggcaaagcaacag
agtgactctggacgcctgagtttgggagcctctcgagggagcagtgtggagagcttgccc
ccgacttctgagggcaagaggatgagtgctgacatgtctgaaatagaagcgaggatcgtg
gcgactacagcctataccaagcctaaacggggccaccgtaaaaccgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacgggcaaccaaggcgtagatccatc
caagacttgactgttactgggacagaacctggtcaggtgagcagcaggtcatccagccct
agtgtcagaatgatcactacctcaggaccaacctcagagaagccagctcgcagtcttcct
tggacccctgatgattccacagataccaatggctcggataactccatcccaatggcgtat
cttacactggatcaccagctgcagcctctagcaccatgcccaaactccaaagaatccatg
gcagtgttcgaacagcattgtaaaatggcacaggaatatatgaaagttcaaaccgaaatc
gcattgttactacagaggaagcaagaactagttgcagaattggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagacgaaaacaaaagc
ctttctacttattaccagcaatgcaaaaaacaactagaggtcatcagaagccagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system