KEGG   Rattus norvegicus (rat): 313121Help
Entry
313121            CDS       T01003                                 

Gene name
Map3k7, Tak1
Definition
(RefSeq) mitogen activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04520  Adherens junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04660  T cell receptor signaling pathway
rno04668  TNF signaling pathway
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05162  Measles
rno05168  Herpes simplex infection
rno05169  Epstein-Barr virus infection
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00686  Toll-like receptor signaling
rno_M00688  MAPK (JNK) signaling
rno_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    313121 (Map3k7)
   04310 Wnt signaling pathway
    313121 (Map3k7)
   04064 NF-kappa B signaling pathway
    313121 (Map3k7)
   04668 TNF signaling pathway
    313121 (Map3k7)
   04152 AMPK signaling pathway
    313121 (Map3k7)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    313121 (Map3k7)
  Cellular community - eukaryotes
   04520 Adherens junction
    313121 (Map3k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    313121 (Map3k7)
   04621 NOD-like receptor signaling pathway
    313121 (Map3k7)
   04622 RIG-I-like receptor signaling pathway
    313121 (Map3k7)
   04660 T cell receptor signaling pathway
    313121 (Map3k7)
   04657 IL-17 signaling pathway
    313121 (Map3k7)
  Development
   04380 Osteoclast differentiation
    313121 (Map3k7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    313121 (Map3k7)
  Infectious diseases
   05162 Measles
    313121 (Map3k7)
   05168 Herpes simplex infection
    313121 (Map3k7)
   05169 Epstein-Barr virus infection
    313121 (Map3k7)
   05145 Toxoplasmosis
    313121 (Map3k7)
   05140 Leishmaniasis
    313121 (Map3k7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     313121 (Map3k7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  MLK family
   313121 (Map3k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Mnd1
Motif
Other DBs
NCBI-GeneID: 313121
NCBI-ProteinID: NP_001101390
RGD: 1309438
Ensembl: ENSRNOG00000005724
UniProt: P0C8E4
Position
5q21
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SDSGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATTAYTKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSLP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcatccgccgcctcgtcctcctcctcgtcttctgccagtgagatgatcgaa
gcgccatcgcaggtccttaacttcgaagagatcgactacaaggagatcgaggtggaagag
gttgttgggagaggagcttttggagtggtttgcaaagctaagtggagagcaaaagatgtt
gcaattaaacagattgaaagtgaatctgagaggaaggctttcatcgtggagctccggcag
ttgtcccgtgtgaaccatcctaatattgtaaagttgtatggagcctgcttgaatccagtc
tgtcttgtgatggagtatgctgaaggaggctcgttgtataatgtgctgcacggtgctgaa
ccattgccttattacactgctgctcatgccatgagctggtgtctacagtgttcccaagga
gtggcctacctgcacagcatgcagcccaaagctctcattcatagggacctcaagcctcca
aacttgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgt
gacatccagacacacatgaccaataataaagggagtgctgcttggatggcacccgaagtg
ttcgaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctttgg
gaggtgataacacgccggaaaccctttgatgagatcggtggcccagctttcagaatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaacttgcctaagcccattgag
agcttgatgacccgctgttggtctaaggacccttctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagctgatgagccgttacagtac
ccctgtcagtactctgatgaagggcagagcaactcagccaccagcacaggctcatttatg
gacatcgcttctacaaataccagtaataaaagtgacacaaatatggaacaagtccctgcc
acaaacgacactattaaacgcttggagtcaaaactgttgaaaaaccaggcaaagcaacag
agtgactctggacgcctgagtttgggagcctctcgagggagcagtgtggagagcttgccc
ccgacttctgagggcaagaggatgagtgctgacatgtctgaaatagaagcgaggatcgtg
gcgactacagcctataccaagcctaaacggggccaccgtaaaaccgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacgggcaaccaaggcgtagatccatc
caagacttgactgttactgggacagaacctggtcaggtgagcagcaggtcatccagccct
agtgtcagaatgatcactacctcaggaccaacctcagagaagccagctcgcagtcttcct
tggacccctgatgattccacagataccaatggctcggataactccatcccaatggcgtat
cttacactggatcaccagctgcagcctctagcaccatgcccaaactccaaagaatccatg
gcagtgttcgaacagcattgtaaaatggcacaggaatatatgaaagttcaaaccgaaatc
gcattgttactacagaggaagcaagaactagttgcagaattggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagacgaaaacaaaagc
ctttctacttattaccagcaatgcaaaaaacaactagaggtcatcagaagccagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system