KEGG   Rattus norvegicus (rat): 313717Help
Entry
313717            CDS       T01003                                 

Gene name
Clstn1
Definition
(RefSeq) calsyntenin 1
  KO
K22659  calsyntenin 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    313717 (Clstn1)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Cadherin related
   313717 (Clstn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Laminin_G_3 Laminin_G_2 CDC45 SpoIIIAH V_ATPase_I UQ_con EphA2_TM Cadherin_C_2 Zip
Motif
Other DBs
NCBI-GeneID: 313717
NCBI-ProteinID: NP_001007093
RGD: 1306458
Ensembl: ENSRNOG00000016398
UniProt: Q6Q0N0
Position
5q36
AA seq 952 aa AA seqDB search
MLRRPAPALARAVRLLLAGLLYGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLI
ALDKDSPLRFAGEICGFKIHGQNVPFDAVVVDKSTGEGIIRSKEKLDCELQKDYTFTIQA
YDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSYKAAVVEGKQHGSILRVEAVDA
DCSPQFSQICSYEILTPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED
VLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVFPSIHLETCDEPVASVQATVELETSHI
GKGCDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHDSDQVFEFNGTQA
VRIPDGVVTLDPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFL
LRQDPSEEKKYRPAEFHWKLNQVCDEDWHHFVLNVEVPSVTLYVDGVSHEPFSVTEDYPL
HPTKIETQLVVGACWQGGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDLQV
PEDGNRGVQIQTSSSQAVLTLEGENVGELDKAMQHISYLNSRQFPTPGIRRLKITSTVKC
FNEAACIEVPPVEGYVMVLQPEEPKISLSGVHHFARAASEFESPEGVSLFPELKIISTIT
REVEPEADGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELNAEQESLEVDVARLQQKGIE
VNHSDLGVVFTGVETMASYEEVLHLLRYRNWHTRSLLDRKFKLICSELNGRYLSNEFKVE
VNVIHTANPVEHANHMAAQPQFVHPEHRSFVDLSGHNLASPHPFAVVPSTATVVIVVCVS
FLVFMIILGVFRIRAAHQRTMRDQDTGKENEMDWDDSALTITVNPMETYEDQHSSEEEEE
EEEEEESEDGEEEEDITSAESESSEEEEGGPGDGQNTTRQQQLEWDYSTLSY
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgccctgcgcccgcgctggcccgggctgtccggctgctgctggcggggctg
ctgtacggcggcggggtctgggccgcgcgagttaacaagcacaagccatggctggagccc
acctaccacgggatcgtcaccgagaacgataacacggtgctgctcgacccccccctcatc
gccctggacaaagactcaccgctgcgctttgcaggtgagatttgtggctttaaaatccac
gggcagaatgtccccttcgatgccgtggtagtggataagtccacgggtgagggaataatc
cgatcaaaagagaaactggactgtgagttgcagaaagactatacattcaccatccaggcc
tacgactgcgggaagggacccgatggcaccggtgtgaaaaaatctcacaaagcaaccgtg
cacatccaggtgaacgacgtgaatgagtacgcccccgtgttcaaggagaagtcgtacaag
gcggccgtggtggagggcaagcagcacggcagcatcctcagggtggaggccgtggatgca
gactgctcgccccagttcagccagatctgcagctatgagattctcaccccagatgtgccg
ttcactgtggacaaagacggttacatcaaaaacacagagaagcttaactacggcaaagag
catcagtataagctcactgtcaccgcctatgactgtgggaagaaaagagccacggaggac
gtcctggtgaagatcagcgttaagcccacctgcagccccgggtggcaaggctggagcagc
agaattgaatatgagcccggcacaggcgctttggccgtcttcccgagcatccacttggag
acctgcgacgagcctgtcgcctctgtgcaggccacagtggagctggagaccagccacata
gggaaaggctgcgaccgagacacctactccgagaagtccctccaccggctctgtggggct
gctgctggtacctcagagctgctcccgtcgcccagtagctccttcaattggaccgtcggc
ctccccactgacaacggccatgacagtgaccaggtctttgagttcaatggcacacaggcg
gtgcggatcccagacggtgttgtgacccttgaccccaaagagccttttacaatttccgtg
tggatgcggcatgggccttttggccggaagaaggagacaattctctgcagttcggataaa
acagatatgaaccgacaccattattcgctctatgtccacgggtgcagactcattttcctc
ctccgtcaggacccgtctgaggagaagaagtacaggcctgcggagttccactggaagctg
aaccaagtctgtgatgaggattggcaccactttgtcctcaatgtggaagtcccaagtgtg
accctctatgtggacggcgtctctcatgagcccttctccgtgaccgaggactacccactt
catccaaccaaaatagaaactcagcttgtggtcggagcttgctggcaaggtggtgacctg
cacatgacgcagtttttccgaggtaacctggctggcctcacagtccgttctgggaaactg
gcagataagaaagtgatcgactgtctgtacacctgcaaagaggggctggacctgcaggtc
cctgaggatggcaacagaggggtgcagatccaaacaagctccagtcaggcggtattgacc
ttggagggggagaatgtcggagagttggataaggccatgcagcacatttcttacctcaac
tcaaggcagttccccacaccaggcatccgcaggctgaaaatcaccagcaccgtcaagtgc
tttaatgaggcggcttgcatcgaggtgcctccggtggagggctacgtgatggttttacag
ccagaagaacccaagatcagcctgagtggggtccaccactttgcccgcgcagcttccgag
tttgagagcccggagggtgtttcccttttccctgagctgaaaatcataagcaccatcacc
agagaggtggagcccgaggcggacggggctgaggaccccacagtgcaagagtccctggtg
tcggaggagattgtgcacgacctggacacctgtgaggtcacggtggaaggggaggagctg
aacgcagagcaggagagcctagaggtggacgtggcccgcctccagcagaagggcatcgaa
gtgaaccactctgacctgggcgtggtcttcacaggtgtggaaaccatggcaagctacgag
gaggttctgcacctcctgcgctatcggaattggcacaccaggtccctgctggaccggaag
ttcaagctcatttgctcggaactaaatggtcgttacctcagcaacgagttcaaggtggag
gtgaatgtgatccacacagccaaccccgtggaacacgctaatcacatggccgcccagcca
cagtttgtccaccctgaacaccgatccttcgtggacctgtctggtcacaacttggccagt
cctcacccatttgcagttgtccccagcacggcgactgtcgtgattgtggtatgtgtcagc
ttcctggttttcatgatcatcctgggggtgtttcggatccgagctgcacatcagcgaacg
atgcgggaccaggacaccgggaaggagaacgagatggactgggatgactctgccttgacc
atcactgtcaaccccatggagacgtacgaggaccagcacagcagtgaggaggaggaagaa
gaggaagaggaggaggagagtgaagacggggaggaggaggaggacatcaccagtgccgag
tcagagagcagtgaggaggaggaaggcggccccggggacggccagaacaccacccggcag
cagcagctagaatgggactactccacactcagctactaa

DBGET integrated database retrieval system