KEGG   Rattus norvegicus (rat): 314961
Entry
314961            CDS       T01003                                 

Gene name
Asap1, Ddef1
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314961 (Asap1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    314961 (Asap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314961 (Asap1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    314961 (Asap1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    314961 (Asap1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   314961 (Asap1)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_1 Ank SH3_9 BAR SH3_2 Ank_4 Ank_3 Ank_5 PH_3
Other DBs
NCBI-GeneID: 314961
NCBI-ProteinID: NP_001037710
RGD: 1307379
Ensembl: ENSRNOG00000058733
UniProt: Q1AAU6
Position
7q33
AA seq 1144 aa
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYEMKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
PKEVGGLYVPSRANSDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRKCA
VKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVTWI
SVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTN
LGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSP
KPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAEGVE
LMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCSMYG
KPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWN
LRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYG
AFTNQIFVSTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKKRSP
PPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPSSSSKTANKFEGLSQQASTSSAKTA
LGPRVLPKLPQKVALRKTETSHHLSLDRANIPPETFQKSSQLSELPQKPPLGDLPPKPME
LAPKPQIGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQAS
DLSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTG
KNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVH
ILSD
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgagatcttcagcctcccggctctccagtttttcctcaagagattcactatggaatcgg
atgccggaccagatctccgtgtccgagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacaccgtcacgctgctg
gaggaggctctagaccaagatagaacagccctccagaaagtgaagaaatctgtgaaagca
atatataattctggtcaagatcatgtacaaaatgaggaaaactatgcacaagttctggat
aagtttggaagtaattttttaagcagagacaaccctgacctgggcactgcttttgtcaag
ttttctacacttacaaaggaactgtccacgctgctgaaaaatctgctccagggtctgagc
cacaatgtgatcttcaccttggattccttgttaaaaggagacctgaagggggtcaaagga
gatctcaagaagccatttgacaaagcctggaaagattatgagatgaagtttacaaaaatc
gagaaggagaaaagagagcacgcaaaacagcacgggatgatccgaacagagataacagga
gctgagattgcagaagaaatggaaaaggaacggcggctttttcagctccagatgtgtgaa
tatctcattaaagttaatgaaatcaagaccaaaaagggtgtggacctgctgcagaacctc
ataaagtattatcatgcacaatgcaatttctttcaggatggcttgaaaacagctgataaa
ctgaaacagtacattgaaaagctggctgctgacttatataatataaagcaaacccaagat
gaagaaaagaaacagttaactgcactccgagacctaataaaatcctctctgcagcttgat
ccgaaagaagtaggtggtttatatgttcccagcagggctaacagtgactctcagagccgg
caaggtggctacagtatgcatcagctccagggcaacaaggagtatggcagtgaaaagaag
ggctttctgctgaagaagagtgacgggatccggaaagtgtggcaaagaaggaagtgtgct
gtcaagaatgggatactgaccatttcacatgcaacttccaacaggcagcctgctaagtta
aacctcctcacctgccaggtgaaaccgaatgctgaggacaagaagtcttttgacctgata
tcacataatcgaacatatcactttcaggcagaagacgagcaggactatgtaacgtggata
tcagtactgacgaatagcaaagaagaggccctaaccatggccttccgtggtgagcagagc
acaggggagaatagcctggaggatctgaccaaagccatcattgaggatgtacagcgactc
cctgggaatgacatctgctgtgactgtggctcatcagaacccacatggctttccaccaac
ttgggtattttgacctgtatagaatgttccggaatccatagggaaatgggggttcatatt
tctcgcattcagtctttggaactagacaaattaggaacttctgaactcttgctggccaag
aatgtaggaaacaatagttttaatgatattatggaagcaaatttacccagcccttcacca
aagcccaccccttcaagtgatatgactgtacggaaagagtacatcactgcaaagtatgtt
gaccaccggttctccaggaagacctgtgcctcttcctcagcaaagctgaatgaattgctt
gaggccatcaagtccagggacttacttgcactaatccaagtctatgcagagggagtggag
ttaatggagccactgctagaacctgggcaggagcttggggagacagctcttcaccttgct
gtcaggaccgcagaccagacgtctctccatctggtggatttccttgtccaaaactgtggg
aacctggataagcagacgtccgtggggaatacggtgttgcactattgcagcatgtacggc
aagcccgagtgtctgaagctgctgcttaggagcaagcccaccgtggacattgttaaccaa
aatggagaaactgccttggatatagcaaagagactcaaagctacgcagtgcgaagatctg
ctttcccaagctaagtctgggaagttcaacccgcatgtccatgtagagtacgagtggaat
cttcgacaggacgagatggatgagagcgatgacgacctggatgacaaaccaagccccatc
aaaaaggagcgctcacccagaccacagagcttctgccactcatccagcatctcaccacag
gacaagctggcactgccagggttcagcactccacgggacaaacagcggctctcctacgga
gccttcaccaaccagatcttcgtctctacgagcacagatttgcccacatcacccaccagt
gaggctccccctttaccgcctaggaatgccgggaaaggtccaactggcccaccttcaaca
ctccctctaggcacccagacctctagtggcagctccaccctatccaagaagaggtctcct
cccccaccaccaggacacaagagaaccctgtctgaccctcccagcccactacctcatggg
cccccaaacaaaggcgcaattccttggggtaacgatgtgggcccatcatcttcaagtaaa
acagcaaacaagtttgagggactatctcagcaagcaagcaccagttctgctaagactgcc
cttggcccgagagtgcttcctaaactacctcagaaagtggcactaaggaagacagagacc
agccatcatctttccctcgacagagctaacatcccacctgagacttttcagaaatcatca
cagttgtcggagttaccccaaaagccaccacttggagacctgcccccaaagcctatggaa
ctggcccccaagccccaaattggagagttgccgcctaagcctggagagctgccccctaag
ccccaattaggtgacctgccccccaagccacagctctcagacttacctcccaagccacag
atgaaggaccttccccccaagccacagctgggggacctgctggcaaagtctcaggctagc
gatttgtcggccaaggtgcagccaccctcagaggtcacacagaggtcacacactggggat
ctgtctccaaatgtgcagtccagagatgccatccagaagcaagcatctgaggactccaac
gacctcacacccacgctgccagagacacccgtaccactgcccagaaaaatcaatacgggg
aaaaataaagtgaggcgtgtgaagaccatttatgactgccaggcagacaatgacgatgag
ctcacatttattgagggtgaagtgatcattgtcactggggaagaggaccaggagtggtgg
attgggcatatcgaaggacagcctgaaaggaagggtgtctttccagtgtcctttgttcac
atcctgtctgactag

DBGET integrated database retrieval system