KEGG   Rattus norvegicus (rat): 361842
Entry
361842            CDS       T01003                                 

Gene name
Sar1a, Sara1
Definition
(RefSeq) secretion associated, Ras related GTPase 1A
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    361842 (Sar1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    361842 (Sar1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361842 (Sar1a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    361842 (Sar1a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     361842 (Sar1a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    361842 (Sar1a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    361842 (Sar1a)
SSDB
Motif
Pfam: Arf SRPRB G-alpha Roc Ras MMR_HSR1 GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 361842
NCBI-ProteinID: NP_001007740
RGD: 1359540
Ensembl: ENSRNOG00000000557
UniProt: Q6AY18
Position
20q11
AA seq 198 aa
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMT
DETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSV
LKRQGYGEGFRWLSQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtctttcatctttgagtggatctacaatggcttcagcagtgtgcttcagttcctagga
ctctacaagaaatctggaaaacttgtattcttaggtttggacaatgcgggcaaaaccact
cttcttcacatgctgaaagatgacagactaggccagcacgtaccaacactccatcccact
tcagaagaactgacgattgctggaatgactttcaccacttttgatcttggtgggcacgag
caagcacgtcgggtttggaaaaattacctcccagcaattaatggaatagtttttctggtg
gactgtgcagatcattctcgtctcatggaatccaaagttgaacttaatgctttaatgact
gatgagacaatatccaacgtgccaatccttatcttgggaaacaaaattgacaggacagat
gcaatcagtgaagaaaaactccgtgaaatatttgggctctatgggcaaaccacaggaaag
gggaatgtgactctgaaggagctgaacgcccgccccatggaagtgttcatgtgcagtgtg
ctcaagaggcaaggctacggcgagggtttccgctggctttcccagtatattgactga

DBGET integrated database retrieval system