KEGG   Rattus norvegicus (rat): 362788Help
Entry
362788            CDS       T01003                                 

Gene name
Traf3
Definition
(RefSeq) Tnf receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    362788 (Traf3)
   04668 TNF signaling pathway
    362788 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    362788 (Traf3)
   04621 NOD-like receptor signaling pathway
    362788 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    362788 (Traf3)
   04657 IL-17 signaling pathway
    362788 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362788 (Traf3)
   05203 Viral carcinogenesis
    362788 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    362788 (Traf3)
  09172 Infectious disease: viral
   05162 Measles
    362788 (Traf3)
   05164 Influenza A
    362788 (Traf3)
   05161 Hepatitis B
    362788 (Traf3)
   05160 Hepatitis C
    362788 (Traf3)
   05168 Herpes simplex virus 1 infection
    362788 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    362788 (Traf3)
   05169 Epstein-Barr virus infection
    362788 (Traf3)
   05165 Human papillomavirus infection
    362788 (Traf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 MPS2 zf-C3HC4_2 Spc7 Spc29 Tropomyosin_1 T3SSipB FliJ KxDL BLOC1_2 DUF1664 LMBR1 DUF3450 SPATA24
Motif
Other DBs
NCBI-GeneID: 362788
NCBI-ProteinID: NP_001102194
RGD: 1304633
Ensembl: ENSRNOG00000008145
UniProt: D3Z9G0
Position
6q32
AA seq 567 aa AA seqDB search
MEPSKKMGAAGAAQPNPPLKLQPDRGAASVLVPEQGGYKEKFAKTVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNEG
RGCVEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRRDLRDHVEKACKYREATCAHCK
SQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggagccaagcaagaagatgggtgctgctggcgcagcgcagcccaacccacccctcaag
ctgcagcccgatcgcggcgcagcgtcagtgctcgtgccggagcaaggaggctacaaggag
aagttcgcgaagacagtggaggacaagtacaagtgcgagaagtgccgcctggtgctgtgc
aacccgaagcagacggagtgtgggcaccgcttctgtgagagctgcatggccgccctgctg
agctcctcaagtccaaaatgcacagcctgccaagaaagcatcatcaaagacaaggtgttc
aaggataattgctgcaagagagagatcctggcccttcagatctactgtcggaacgaaggc
agaggctgcgtggagcagctgactctgggacatctgctggtgcacctgaaaaacgagtgt
cagtttgaggaactcccctgcctgcgtgccgactgcaaagagaaagtactgaggagagac
ttgcgggatcacgtggaaaaggcctgtaaataccgagaggccacgtgcgcccactgcaag
agccaagtccccatgatcacactgcagaaacatgaagacacggattgtccctgtgtggtg
gtgtcctgccctcataagtgcagcgttcagactcttctgaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccacgaggccagctccgcggtccagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccttgctgcagaatgaaagt
gttgagaaaaacaagagcatacaaagtctgcacaaccagatatgtagctttgagattgaa
attgagagacaaaaggagatgcttcgaaacaatgagtccaaaatccttcatttgcagcga
gtaatagacagccaagcagagaaactgaaagaactcgacaaggagatccgtcccttccgg
cagaactgggaggaagcagacagcatgaagagcagtgtggaatccctccagaaccgtgtg
actgagctagaaagcgtagacaaaagtgcagggcaggcagctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgctgagtgtccacgacatccgcttggccgac
atggacctgcgcttccaggtcctcgagactgccagctacaatggtgtgctaatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctatctctctac
agccagcctttctacacaggttattttggctataagatgtgtgcccgggtctacctgaac
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgcggagaa
tatgatgctctgttgccgtggccattcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgacgccatctgggagatgcgttcaagcctgatcccaacagcagcagcttc
aagaagcccacgggagagatgaacatcgcctctggctgcccagtctttgtcgcccaaact
gttctcgagaacgggacgtacattaaagatgatacaatttttattaaagtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system