KEGG   Rattus norvegicus (rat): 363259
Entry
363259            CDS       T01003                                 

Gene name
Obsl1, RGD1306073
Definition
(RefSeq) obscurin-like 1
  KO
K19574  obscurin-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    363259 (Obsl1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   3M complex
    363259 (Obsl1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Ig_5 Izumo-Ig Ig_4 Ig_6 C2-set_2 BiPBP_C fn3
Other DBs
NCBI-GeneID: 363259
NCBI-ProteinID: XP_006226950
RGD: 1306073
Ensembl: ENSRNOG00000015346
UniProt: D3ZZ80
Position
9q33
AA seq 1805 aa
MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPTVLWEKGGQQLVASERLSF
PEDGAEHGLLLSGALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAPEPEPQSSECPPPP
PGTGEGAPVFLTGPQSQWVLRGAEVVLTCQVGGLPEPKLYWEKDGMALDEVWDSSHYTLE
PDRGASDGGASLTLRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPHENPPQDPDEP
PVRVIEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHLEGRPLLPDRRRLMYRDRDG
GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIVVL
ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLVIHRLKADDDGVYLCEMRGRVRT
VANVTVKGPILKRLPRKLDVLEGENAVLLVETQEAGVQGCWSRDGEELPATCQSSCGHMH
ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPVLVEMFKGQKNTVLLTWKP
PEPPPETSFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPTEGDYRFRICTVSEHGR
SPHVVFNGSAHLVPTARLVSGLEDVQVYDGEDAVFSLDLSTIIQGSWFLNGELLKNDEAE
GQVEPGALRYRIEQKGLQHRLILQTVKHQDNGALVGFICPGVQDSAALSIQESPVHILSP
QDKVLLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESESLVVKMDGRKHRLILPEAQV
RDSGEFECRTEGISAFFSVTVQDPPVHIVDPQEHVFVHAITSESVMLTCEVDREDAAVHW
YKDGQEVEESAVIVLEKEGPRHRLVLPAAQPSDGGEFQCVVGDERAYFTVTITDVSSWIV
YPNGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVLESPALLLEKEDTIRRLVLPSV
QLEDSGEYLCEIHDESASFTITVTEPPVRIIYPQDEVTLHAVSLECVVLTCELSRVDAPV
RWYKDGLEVEETEALVLQSDGPRRRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER
IVHPVARSLDLQFGAPGHVELRCEVAPAGSQVRWYKDGLEVEVSDALQLGAEGPARTLTL
PHAQPEDAGEYVCETRDEAVTFNVSLAELPVQFLAPEAVPNPLCVVPGEPVMLSCELSRA
SAHVSWSHNGNPVKQGEGLELRAEGPRRILCIQAADLAHTGVYTCQSGTAPGAPSLSFNV
QVAEPPPVKLVSELTPLTVHEGDDATFQCEVSPPDAEVTWLRNGAIVTPGPQLEMVHSGS
SRTLIIRGCQLKDAGTVTARAGATDTSARLHVRETELLFLRRLQDVRAEEGQDVYLEVET
GRVGAPGAVRWLRGGEPLPLDSRLTTAQDGHVHRLSIHGVLLTDQGTYGCESHHDRTLAR
LSVRPRQLRELRPLEDVTVHEGGSATFQLELSQEGVTGEWAQGGVRLHPGPKCHIHSEGR
THCLVLSGLGLADSGCISFTADTLRCAARLTVREVPVTIVQGPQDLEVTEGDTATFECEL
SQTLADVIWEKDGQALSLSPRLRLQSLGTRRLLLLRRCSSSDAGTYCCAVGTARSGPARL
TVREREVSVLGELRSLSAREGDSATFECTVSESETTGRWELGGRALRPGGRVRIRQEGKK
HILVLSELRTEDTGEVCFQAGPAQSLARLEVEALPLQMCRRPPREKTVLVDRRAVLEVTV
SRPGGHVCWMREGVELCPGSKYEMRSHGTTHSLVIHDVRPEDQGTYSCQAGQDSADTQLL
VEGDD
NT seq 5418 nt   +upstreamnt  +downstreamnt
atgaaggccagttcaggggatcaggggagtcccccgtgtttcctacgcttcccgcggccc
gtgcgggtggtaagtggcgcggaggccgagctcaaatgcgtggtcctgggagagccgccg
cccaccgtcttgtgggagaaaggcgggcagcagctggtggcctcggagcgcctgagcttt
ccagaggacggcgccgagcacggcctgctgttgagcggcgcgctgcccaccgacgccggg
gtctacgtgtgccgcgcccgcaacgcggccggagaggcctacgcggcggccgccgtcacc
gtgctggaacccccggccccagagcccgagccccagtcttccgagtgtccgccgccgcct
ccgggcaccggggagggcgccccggtgtttctgacgggaccccagtcccagtgggtgctg
cgaggggcggaggtggtgctgacgtgccaggtgggaggcctcccggagcccaagctgtac
tgggagaaggatgggatggccttggacgaagtgtgggacagcagccactacacgctggag
ccggaccgcggcgcgagtgacgggggcgcaagcctgacgttacgcatcctggcagcgcgg
ctgcccgattccggggtgtacgtgtgccacgcccgcaacgcgcacggccacgcgcaggcg
ggcgcgctgctccaggtgcaccagccccacgagaacccgccccaggatcccgatgagccc
cccgtacgcgtgatagagccgctcaaatgcgcgcccaagaccttctgggtgaacgagggc
aagcacgccaagttccgctgctacgtgatgggcaagcctgagcccgagatcgaatggcac
ttggagggccgccctctgctccccgaccgccgccgcctcatgtaccgcgaccgtgacggt
ggctttgtacttaaggtgctctactgccaggccaaggaccgtggcctctacgtgtgcgcg
gcgcgcaactccgcgggccagaccctaagcgcggttcagctgcacgtgaaagaaccgcgc
ctccggttcacaaggcctctgcaggatgtggagggtcgagagcatgggatcgtagtccta
gagtgtaaagtacccaactctcggattcccaccgcctggttccgagaggaccagcgactg
ttaccctgccgcaagtacgagcagattgaagaaggcactgtgagacgcctcgtcatccac
aggctgaaggcagatgacgatggtgtctatctgtgcgagatgcggggtcgagtgcgcacg
gtagccaacgtgactgtcaaaggacccatcctgaagcgcttaccccggaagctggatgtc
ctggagggagagaacgcggtgctgctggtggagactcaagaagctggggtccaggggtgc
tggagccgtgatggggaggagctgccagccacctgccagagtagttgtggtcacatgcat
gccctggtccttcctggggtgacccgagaagatgctggcgaggtcacctttagcctgggc
aactcccgtaccaccaccctgctcagagtcaaatgtgtcaagcacagtcctcctgggccc
cctgtactggttgagatgttcaaaggccaaaagaacacagtcctgctgacctggaagccc
ccagagccacctccagaaacctccttcatctaccgcctggagcggcaggaagtcgggtct
gaggattggatccagtgcttcagcattgagaaagctggagccgtagaggtgccaggggac
tgtgtacccaccgagggtgactaccgcttccgcatctgcacagtcagtgaacatggccgc
agtccccatgtcgtgttcaatggctctgctcaccttgtgcccacagctcgcctggtgtca
ggcctggaagatgtgcaggtgtatgacggggaagatgccgtcttctcccttgatctgtcc
accatcatccagggctcttggttccttaatggagagctgctcaagaatgatgaggcagag
ggccaggtggagcctggagccctccggtaccgaatagagcagaagggcctgcagcacaga
ctcatcctgcaaacggtcaagcaccaggacaatggggccctggtaggcttcatctgccct
ggtgtgcaagattctgctgccctcagtatccaagaaagcccagtgcacatcctgagtccc
caggataaggtgttgctgaccttcacgacctctgaacgggtagtgttgacctgtgagctc
tcaagagtggattttccagcaacctggtacaaggatgggcagaaggtggaggagagcgag
tcgctcgtagtgaagatggatgggcgcaaacaccgactgatcctgcctgaggctcaagtc
cgagacagtggtgaatttgaatgcagaacggaagggatctcagccttcttcagtgtcact
gttcaagatcccccagtgcacatcgtggacccccaagaacatgtgtttgtccatgccatc
acttccgagagtgtcatgctgacctgtgaggtggaccgagaggacgcagctgtgcactgg
tacaaggatgggcaggaggtggaggagagtgccgtcatcgtattagaaaaggaagggccc
cgtcaccgcctggtgcttcctgcagctcagccctctgacgggggcgagtttcagtgtgtg
gtgggagacgaacgggcctacttcacagttaccatcacagatgtctcttcatggatcgtg
taccccaatggcaaagtgtatgtggcagctgtacgcctagaacgtgtggtgctgacctgt
gagctgtgccggccctgggctgaggtgcgctggaccaaagatggggaggaggtattggag
agcccagcactgctcctggagaaggaggataccatccggcgcctggtgctgccctctgtc
cagcttgaggactctggcgagtacctgtgtgaaatccatgatgagtcagcttccttcacc
atcaccgtcacagagccccctgtgcggatcatatacccccaggatgaggtgaccttacat
gctgtgagtctggaatgtgtggtgctcacatgtgagctgtcccgagtggacgctcctgta
cgatggtacaaggacgggctagaggtggaggagacggaggccctggtgctccagagtgat
gggcctcgtcgccgcctggtgttgcctgcggcccagccggaggacgggggcgagtttgtg
tgtgatgctggggatgattcagccttcttcactgtcactgtcacagctccaccagagaga
attgtgcacccagtggcccgatccctggatttgcagtttggggctccaggacacgtggag
ctacgctgtgaagtggccccggctgggtctcaggtgcgctggtacaaggatgggctagag
gtagaagtgtcagatgcactgcagctgggtgcggaggggcccgcccgcactctcaccctg
ccccacgcccagcctgaggatgccggggagtatgtatgtgagacccgagatgaggctgtc
accttcaacgtcagcctggctgagcttccagtgcagtttctggctccagaggcagtccca
aacccgctctgcgtggttcctggggagccagtgatgctgagctgtgagctgtcccgagca
agcgcacacgtgtcctggagccataatgggaaccctgtgaagcagggtgaaggactagag
cttcgagctgagggtcctcgccgaatcctctgcatccaggctgcagacctagctcacaca
ggtgtctacacctgccagtctgggacagcccctggggccccaagcctcagcttcaatgtc
caggtggctgagccccctccagtgaagctggtctcggaactgacgcccctgacagtccac
gagggtgatgacgccacattccagtgtgaagtttcgccaccagatgccgaggtcacctgg
ctacgcaatggagccattgtcactccagggccacagctggaaatggtccacagtggttca
agccgcactttgatcatccgaggctgccaactcaaagacgcagggaccgtgacggcacga
gctggagccactgacacaagtgccaggctccatgttcgagagacagagctgctcttcctg
cggcggctgcaggatgtgcgggcggaggaaggccaggatgtgtaccttgaggtggagaca
ggccgagtaggtgcacctggagctgtccgctggctacgaggtggggaacctcttcccctg
gactctcgcctgaccacggcccaggatggccatgtccaccgtctctctatccatggcgtc
ctgcttaccgaccagggtacctacggctgcgagagccaccacgatcgcactctggccagg
ctcagtgtgaggcctcggcagctgagggaacttcggcctctggaggatgtgaccgtccat
gaggggggcagtgccaccttccagctggagctgtcccaggagggtgtgaccggagaatgg
gcccagggtggagtgcggctacacccagggcccaagtgccacattcattcagaaggccgc
actcactgcttggtgctaagcggcctgggtctggctgactcgggctgtatctccttcact
gcggatacccttcgatgtgccgctcggctcacagtgagagaggtcccagtgactattgtg
caggggccacaggacctagaagtgactgaaggtgacacagccacgttcgagtgcgagctt
tcccagactttggctgacgtaatatgggagaaggatgggcaggcgctctctctcagcccg
cgcctccggctccagtctctcggcacgcgccgccttctgcttctgcggcgttgcagctcc
tcagacgccgggacctactgctgcgctgtggggacagctcgctcggggcctgcgcgcttg
accgtgcgcgaacgagaggtgtctgtgctcggtgagctcaggtcgcttagcgcccgcgaa
ggagacagcgctacattcgagtgcaccgtgtcggagtccgagacaaccggacgctgggag
ctcggaggccgcgcgctgagacccggaggccgcgttcgcatccgacaggaagggaagaaa
cacattctggtgctgagcgaactgcgaaccgaggacaccggagaagtctgcttccaggcg
ggacccgcccagtccttggctcggctggaggtggaggcgttgcctctccagatgtgccgc
cgcccacctcgcgagaagacggttctggtcgaccgcagggcggtgttggaggtgactgtg
tcccgccctgggggccacgtgtgttggatgcgggagggggtcgaattatgcccgggaagc
aagtatgagatgcgtagccacggcaccacccacagcctagtcatccatgacgtccgacct
gaggaccagggcacatacagctgccaagcaggccaggacagtgctgacacacagctgctg
gtagagggtgacgactga

DBGET integrated database retrieval system