KEGG   Rattus norvegicus (rat): 363509Help
Entry
363509            CDS       T01003                                 

Gene name
Arhgef6
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor 6
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04810  Regulation of actin cytoskeleton
rno05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    363509 (Arhgef6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    363509 (Arhgef6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363509 (Arhgef6)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    363509 (Arhgef6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF SH3_9 SH3_2 CH SH3_1 RhoGEF67_u1 PH CAMSAP_CH ZapB DUF2204
Motif
Other DBs
NCBI-GeneID: 363509
NCBI-ProteinID: NP_001005565
RGD: 1359674
Ensembl: ENSRNOG00000000869
UniProt: Q5XXR3
Position
Xq37
AA seq 772 aa AA seqDB search
MNPEERVVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLISRLLPGSVEKYCQEP
QTEADCIDNINDFLKGCATLQVEVFEPDDLYSGANFSKVLNTLLAVNKATEDQLSERPCG
RSSSLSATTSSQTNPQAAVPSTTPEQQSEEKAAEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKPSERPLSPKAVKGFDTAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEFTCLLGNFEEVCTFQQTLC
QALEECSKSPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLERFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKSLMGQCQD
LRKRKQLELQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACEEKEERYFLLFSSVLIM
LSASPRMSGFMYQGKVPIAGMVVTRLDEIEGNDCTFEITGSTVERIVVHCNNNQDFQEWM
EQLNRLTKGPASCSSLSKTSSSSCSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKTSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSASFQQGTRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYALKDE
VKELKQENKKMKQCLEEELKSRKDLEKLVRKLLKQTDESIRAESSSKTSILQ
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagaagaacgcgttgtgacctggcttatatctttgggagttctagagtccccc
aaaaagaccatctgtgatccagaagagttcttgaagtcttcgctgaaaaatggggtagtg
ttgtgcaaactcataagcagacttctgcctggctcggtggagaagtattgtcaggaaccc
caaactgaggccgactgcatcgacaacatcaatgacttcctgaaaggatgtgcaaccctt
caagtggaagtgtttgagcctgatgacctctattctggggccaatttctccaaggttctg
aatacccttctagctgtcaacaaagcgacagaagatcagctatcagaaagaccatgtgga
cggtcctcttctcttagtgctacgaccagctctcagacaaacccacaggcagccgttccc
agcacaactccagagcagcaaagcgaggaaaaggcagcggagatgacggaaaatggaagt
caccagttgatagtaaaggcaagattcaacttcaagcagaccaatgaagatgaattgtca
gtgtgtaaaggggacatcatttatgtcactcgagttgaagaaggaggctggtgggaaggc
acattaaatgggagaaccggatggttccctagtaattatgttcgagaaattaaacccagt
gagagacctctgtcccctaaggctgtcaaaggatttgacactgctccacttaccaagaat
tactacactgtggtgttacagaacatcttggacactgaaaaagaatatgccaaagaactt
cagtctcttcttgttacttacctaagacctttgcagtctaataacaacctgagtactgtg
gagtttacatgcttattgggaaactttgaagaagtatgcacatttcaacagacactctgc
caagccctggaagaatgctcaaagtctccagaaaaccagcacaaagtaggaggctgccta
ctgaacctcatgcctcattttaaatcgatgtacctggcttactgtgcaaatcatccttca
gctgtcaacgtgctcacccagcatagtgatgatctagaacgattcatggaaaatcaaggt
gcatccagccccggtatcctcattttaacaacaagtctcagcaaaccattcatgcgactg
gaaaagtatgttactctcttgcaagaactggaacggcatatggaggacactcatccagat
catcaggatattctgaaagctatcatagcattcaaaagcctcatggggcagtgccaagat
ctgagaaagagaaagcagctggaattgcagatcctttcggaacctattcaggcatgggaa
ggagatgatattaagactttgggaaatgtgatctttatgtcacaagtagtgatgcagcat
ggagcctgtgaggaaaaagaggaacgatattttctgctcttttcaagtgtcttgatcatg
ttgtctgcaagtccgcggatgagtggctttatgtatcagggaaaggtaccaatagcaggg
atggtcgtgaccagattggatgaaattgaaggaaatgactgtacattcgaaatcaccggt
agcacggtagagagaattgtggtccactgcaacaataaccaggacttccaggagtggatg
gagcagctgaacagactgaccaaaggaccagcctcctgcagttcattgtctaagacctcc
tcatcatcatgtagtactcattcttcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagtttaagttgcctacgacctgcacctccactt
agaccatcagcagcactaggttataaagagaggatgtcttatatcttaaaggaatctagt
aagagccccaaaacgatgaagaaatttcttcacaaaagaaagacggagagaaagacatcc
gaggaagaatacgtgattaggaaaagtactgctgccctggaagaggatgctcagattctt
aaggtgattgaagcttattgcaccagcgccagttttcaacaaggtactcgtaaagattca
gttccacaagtactactccccgaggaagagaaactcattattgaagaaactagaagtaat
gggcagaccatcattgaagagaagagccttgttgatactgtctatgccttgaaggatgag
gtcaaggaattgaagcaggagaataaaaaaatgaagcaatgtctggaagaagaattgaag
tcgaggaaggacctagaaaaactggtccggaagctgttgaagcaaaccgatgaaagcatt
cgcgctgaatccagcagcaagacctcgattctccagtaa

DBGET integrated database retrieval system