KEGG   Rattus norvegicus (rat): 365901Help
Entry
365901            CDS       T01003                                 

Gene name
Gnat2
Definition
(RefSeq) G protein subunit alpha transducin 2
  KO
K04631  guanine nucleotide-binding protein G(t) subunit alpha 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    365901 (Gnat2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    365901 (Gnat2)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    365901 (Gnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA DAP3 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 365901
NCBI-ProteinID: NP_001102420
RGD: 1309514
Ensembl: ENSRNOG00000019296
UniProt: D4AA42
Position
2q34
AA seq 354 aa AA seqDB search
MGSGISAEDKELAKRSRELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKSVIYGNVLQSILAIIRAMSTLGIDYAEPSCAEAGRQLNNLADSTEEGTMP
SELVEVIRKLWKDGGVQACFDRAAEFQLNDSASYYLNQLDRITDPDYLPNEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggggagtggcatcagtgctgaggacaaagaacttgccaagaggtccagggagctggaa
aagaagctgcaggaggatgctgacaaggaagccaagactgtcaagctgctgctgcttggt
gcgggagagtcagggaagagcacgatcgtcaaacaaatgaagatcattcaccaggatggc
tactcacccgaagaatgcctagaattcaaatctgtcatctatgggaacgtgttgcagtcc
atcctggctatcatcagagccatgtccacactaggcattgactatgctgaaccaagctgt
gcggaagcggggagacagctcaacaacctggctgactccaccgaggaggggaccatgcct
tccgagctggtggaggtcatcagaaagttgtggaaggacggtggagttcaagcctgcttt
gacagagccgcagagttccagctcaatgactcggcatcttattacctgaaccagctggac
cggattacagaccctgactacctccctaatgagcaagacgtgcttcgatccagagtcaag
acaacaggcatcatcgagaccaagttttctgtaaaagatttgaattttaggatgtttgac
gtgggagggcagagatcagagaggaagaaatggatccactgctttgagggagtcacctgc
atcattttctgtgctgctcttagcgcctatgacatggtgctggtggaggatgacgaggtg
aatcgcatgcatgagtctctacatctgttcaacagcatctgtaaccacaagttctttgcg
gctacttccattgttctctttctcaacaagaaggacctctttgaggaaaaaattaagaaa
gtccacctcagtatctgtttcccggagtatgacggcaacaattcctatgaggatgccggg
aattacatcaagagtcagttccttgacctcaacatgaggaaagatgtcaaagagatctac
agccacatgacttgtgctacggacacacagaacgtcaaatttgtgtttgatgcagtcaca
gacattatcatcaaggaaaacctcaaggactgtgggctcttttaa

DBGET integrated database retrieval system