KEGG   Rattus norvegicus (rat): 366029
Entry
366029            CDS       T01003                                 

Gene name
Zbtb6, Zfp482, Znf482
Definition
(RefSeq) zinc finger and BTB domain containing 6
  KO
K10493  zinc finger and BTB domain-containing protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    366029 (Zbtb6)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     366029 (Zbtb6)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met zf-C2H2_11 zf-H2C2_5 zf-LYAR zf-C2H2_8 zf-C2H2_2
Other DBs
NCBI-GeneID: 366029
NCBI-ProteinID: NP_001102423
RGD: 1306007
Ensembl: ENSRNOG00000009340
UniProt: D3ZBL2
Position
3q11
AA seq 423 aa
MAAESEVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRD
QFLLTQSKHIRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT
EALSKYLEIDLSMKNNQHTDLCQSSDTDVKNEEENSDKDCEIIEISEDSPVNLDPPVKEE
EGDALQSAAETLTSERRGVKSPELSTVDGGFKENEICILHVESIHTDDIENGQFPQPCTS
SNAGMYFPETQHSVINSTVENRVTEVPGNTNQGLFSENSDGSHGTINEIQNLDENFSLRH
QCPRCPRGFLHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCLK
TFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKCQ
NLL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggctgctgagtctgaggttctacacttccagtttgaacagcaaggagatgtggtccta
cagaaaatgaatctcttgagacagcagaatttattttgtgatgtatcgatttatattaac
gatactgagttccaggggcacaaggtgattttggctgcttgctccacttttatgagagat
cagtttttactcacacagtcaaaacacatcagaattaccattctgcagagtgcagaagtt
ggcaggaagttgctgttgtcctgctatactggagcacttgaagtaaaaagaaaagagctt
ttgaaatacttgactgctgccagttaccttcagatggttcacattgtggaaaaatgcaca
gaagctttgtcaaagtatttggaaattgatctttctatgaaaaataaccaacacactgac
ttgtgtcaatcttcagatacagatgttaagaatgaagaagaaaattctgataaagactgt
gagatcattgaaatttcagaagatagtcctgtaaacctagatcctcctgtcaaagaggag
gaaggcgatgcattacaatctgctgcagagacactgacatcagagcgaaggggagtgaag
tcaccagagctctcaacagtagatggtggctttaaagagaatgaaatttgtatccttcat
gtggaatccatccatacagatgatatagaaaacgggcagtttccacagccctgtacctca
tccaacgcaggcatgtatttccctgaaacacaacattcagtgatcaattctacagttgag
aacagagtgacagaagttcctggaaatacaaatcaagggttattttctgagaattctgac
ggaagtcatggtacaataaatgagattcagaatctggatgagaatttttccttgaggcac
cagtgcccccggtgtccccggggctttcttcatgtagaaaactatctgcgccaccttaag
atgcataaactgtttttgtgtttgcagtgtgggaaaacatttacacagaagaaaaatctt
aaccggcacattcgaggacacatgggtatacggccctttcagtgtactgtgtgtctgaaa
acctttactgccaaaagcacacttcaggaccacttgaacatacacagtggtgaccggcca
tataaatgtcattgttgtgatatggatttcaaacacaaatctgctctcaaaaagcactta
acctctgttcatggcaggagcagtggtgaaaaactgtctaggcctgatctcaaatgccag
aatctactgtaa

DBGET integrated database retrieval system