KEGG   Rattus norvegicus (rat): 399679Help
Entry
399679            CDS       T01003                                 

Gene name
Aicda, aid
Definition
(RefSeq) activation-induced cytidine deaminase
  KO
K10989  activation-induced cytidine deaminase [EC:3.5.4.38]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04672  Intestinal immune network for IgA production
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    399679 (Aicda)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    399679 (Aicda)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.38  single-stranded DNA cytosine deaminase
     399679 (Aicda)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APOBEC2 NAD1 APOBEC_N NAD2 SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 RcbX DUF2599
Motif
Other DBs
NCBI-GeneID: 399679
NCBI-ProteinID: NP_001094249
RGD: 1303222
Ensembl: ENSRNOG00000015478
UniProt: G3V7Y8
Position
4q42
AA seq 198 aa AA seqDB search
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRK
AEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLTRQLRRIL
LPLYEVDDLRDAFRILGL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctcttgatgaagcaaaagaagtttctttaccacttcaaaaatgtccgctgg
gctaagggtcggcacgagacctacctgtgctatgtggtgaagaggagagatagtgccacc
tccttctcactggactttggccaccttcgcaacaagtcgggctgccacgtggaattgttg
ttcctacgctacatctcggactgggacctggaccccggccggtgttaccgtgtcacctgg
ttcacttcctggagcccctgctacgactgtgcgcggcacgtggctgagtttctgagatgg
aaccctaacctcagcctgaggattttcaccgcgcgcctctacttctgcgaagaccgcaag
gctgagcctgaggggctgcggaggctgcaccgcgccggagtccagatcgggatcatgacc
ttcaaagactatttttactgctggaatacatttgtagaaaatcatgaaagaactttcaaa
gcctgggaagggctgcatgaaaactccgtcaggctaaccagacagcttcggcgcatcctt
ttgcccttgtatgaagtcgatgacttgagagatgcgtttcgtattttgggactttga

DBGET integrated database retrieval system