KEGG   Rattus norvegicus (rat): 499285Help
Entry
499285            CDS       T01003                                 

Gene name
Adam8, RGD1566394
Definition
(RefSeq) ADAM metallopeptidase domain 8
  KO
K06540  disintegrin and metalloproteinase domain-containing protein 8 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    499285 (Adam8)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    499285 (Adam8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     499285 (Adam8)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   499285 (Adam8)
CD molecules [BR:rno04090]
 Proteins
  499285 (Adam8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 ADAM_CR EGF_2 Peptidase_M10 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 499285
NCBI-ProteinID: XP_006223618
RGD: 1566394
Ensembl: ENSRNOG00000017897
Position
1q41
AA seq 868 aa AA seqDB search
MLGLWLLSILWTPAVAPGPPLPHVKQYEVVWPRRLAASRSRRSLPSQWGLYPESLSYALG
TSEQVFTLHLRKNRDLLGSSYTETYSAANGSEVKEQLHEQDHCLYQGHVEGYEGSAASIS
TCAGLSGFFRVGSTVHLIEPLDADEEGQHAVYQAKHLEQKAGTCGVSETSLDKLGPRTLE
IYRAQPGNWLKPREIRYVELYVVADSQEFQKLGTREAVRQRVLEVVNHVDKLYRELSFRV
VLVGLEIWNKDKFYISRYANVTLENFLSWREQNLLGRHPHDNVQLITGVDFIGTTVGLAK
VSALCSRHSGAVNQDHTRSAIGVASTMAHELGHNLGMNHDENIPGCYCPIPREGGGCIMT
ESIGSKFPKTFSRCSQVDLESFVTNHQTGCLTNVPDVNRFVGGPVCGNLFVERGEQCDCG
TPQDCQNPCCNATTCQLAKGAECAHGACCHECKVKPAGELCRPMKDKCDLEEFCDGQKPT
CPEDAFQQNGTPCPGGYCFDGSCPTLAQQCQALWGPGARAASDSCFAFSIPQGCYGSMYP
SRINRCGVLFCEGGQKPLERSSCTFSSHHGLCQALQTDSNTNTYEFVLQGTKCEEGKVCM
DGNCQDLRVYRSENCSAKCNNHGVCNHKRECHCHAGWAPPYCAQLLADVPVVTESAAVHS
TTASGNWRGLNSGTVGLGLATTTSSNPLLESQKSWSSESLPVSVVVVLVILVAAVVIGAG
IVIYRKAPKQIQRRSVAPKPTSGLSNPLFYTGDSSLPAKSRPPDPPEMVSTNQPPRPIVK
PKRPPPAPPGAMSSPPLPVPVYAPKAPNQLRPDPPTKPLPKLKPKQVKPTFAPPTPPVKP
GTGGTVPGVTQQGAGGSKVALKVPIQKR
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcctctggctactcagcatcttatggacaccagcagtagcccctggacctcct
ttgcctcatgtgaaacagtatgaggtggtatggcctcggcgcctagctgcatcccgctcc
cgcagaagcctgccctcccagtggggcttgtacccagagagtctgagctatgctcttggg
accagtgagcaagttttcaccctgcaccttcgaaagaacagggacttgctgggctcaagc
tacacagagacctactcagctgccaatggctctgaggtgaaggagcagctgcacgagcag
gaccattgcctctaccagggccatgtggaagggtatgagggctcagctgccagtattagc
acctgtgccggcctcagcggctttttccgagtcgggtccactgtccacttgattgagcct
ctggatgctgacgaagaggggcagcatgcagtgtaccaggcaaagcatctggaacagaag
gctgggacctgtggggtcagcgaaaccagcctggataaactagggcctcggaccttagaa
atctacagggctcagcccgggaactggctaaaacctagagaaatccgctatgtggagttg
tatgtggttgcagacagccaagagttccagaagctggggaccagagaggctgtgcgtcag
cgagtgctggaggttgtaaaccatgtggacaagctttatcgggaactcagtttccgagtt
gtcctagtgggcctggagatctggaacaaggacaaattctacatcagccgttatgccaat
gtcacactggagaacttcttgtcctggagggagcagaacttgctagggcggcacccacat
gacaatgtgcaacttatcacgggggttgatttcattgggaccactgttggactggctaag
gtatctgccctgtgttcccgtcactcaggagctgtgaatcaggaccacaccaggagcgcc
attggtgtagcatctaccatggcccatgagctgggccacaacctgggcatgaaccatgat
gaaaacattccaggatgctactgtcctataccacgtgagggtggtggctgcatcatgact
gaaagcattggctccaagttccccaagacattcagcaggtgcagccaggttgacctagag
tcattcgtgacaaatcaccagacaggctgcctgaccaatgttccagatgtcaaccggttc
gtgggtggccctgtgtgtggaaacctatttgtggaacgtggagagcagtgtgactgtggt
acacctcaggattgtcaaaacccctgctgcaatgccaccacttgccagctggccaagggg
gcagagtgtgcccatggtgcctgttgtcatgaatgcaaggtgaagccagctggtgagctg
tgtcgtcctatgaaggacaaatgtgacctggaggagttctgtgatggccagaagccaaca
tgtcctgaagatgccttccaacagaatggtaccccctgtccagggggctactgctttgac
gggagctgccccacactggcacagcagtgccaggctctgtgggggccaggtgcccgggca
gcatccgactcctgctttgcctttagcattcctcagggctgctatgggagtatgtaccct
agcaggatcaaccgatgtggggtgctgttctgtgagggaggccagaaacctcttgaacgt
tcctcctgcactttctcttcccaccatggactctgccaagctctccagactgacagcaac
actaacacctacgagttcgtactccagggcaccaagtgtgaggagggaaaggtttgcatg
gatggaaactgccaggacctccgtgtatacagatctgaaaattgctctgctaaatgcaac
aaccatggggtttgcaaccacaagagggagtgccactgtcacgcgggctgggccccaccc
tactgtgcacagctgctggcagatgtaccagtggtcactgagtctgcagctgtccacagc
accacagcctcggggaactggcggggcctcaacagtggcactgtggggctgggactcgcc
actaccacgtcttctaacccactgctggagagccagaagagctggtcatccgagagcctc
ccagtcagtgtggttgtggtcttggtgatcctggtggctgccgtggtcatcggggcaggc
atcgtcatctaccgaaaggccccaaaacaaatccagaggaggagtgtggcacccaagcct
acctcagggctctccaaccccctattctacacaggggacagcagcctgccagctaagagc
aggcctccagaccctcctgagatggtttctaccaaccaacccccaagacctatagtgaaa
ccaaagaggcctccccctgcacctccaggtgccatgtccagtccaccgctcccagttcct
gtttatgccccaaaggcaccaaaccagcttagacctgatcctcccaccaagcctctccca
aagctaaaacccaagcaggtcaagccaacctttgcacccccaacaccaccagtcaagcct
gggaccggagggactgtgcctggagtgactcagcagggagctggtgggtcaaaggttgct
ctgaaggtccccatccagaaaaggtga

DBGET integrated database retrieval system