KEGG   Rattus norvegicus (rat): 499537
Entry
499537            CDS       T01003                                 

Gene name
Fyb1
Definition
(RefSeq) FYN-binding protein 1
  KO
K17698  FYN binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    499537 (Fyb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    499537 (Fyb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    499537 (Fyb1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   499537 (Fyb1)
SSDB
Motif
Pfam: hSH3 SH3_2 SH3_1 DUF4651 ATX_III
Other DBs
NCBI-GeneID: 499537
NCBI-ProteinID: NP_001102646
RGD: 1563421
Ensembl: ENSRNOG00000013886
Position
2
AA seq 820 aa
MAKFNTGSNPTEEVSTSSRPFKVAGQNSPSGIQSKKNLFDNQGNASPPAGPSNMSKFGTT
KPPLAAKPTYEEKSEKEPKPPFLKPTGVSPRFGTQPNSVSRDPEVKVGFLKPVSPKPTSL
TKEDSKPVILRPPGNKLHNLNQESDLKTLGPKPGSTPPVPENDLKPGFSKIAGAKSKFMP
APQDADSKPRFPRHTYGQKPSLSTEDAQEEESIPKNTPVQKGSPVQLGAKSRGSPFKPAK
EDPEDKDHGTPSSPFAGVVLKPAASRGSPGLSKNSEEKKEERKTDIPKNIFLNKLNQEEP
ARFPKAPSKLTAGTPWGQSQEKEGDKDSATPKQKPLPPLSVLGPPPSKPSRPPNVDLTRF
RKADSANSSNKSQTPYSTTSLPPPPPTQPASQPPLPASHPAHLPAPSLPPRNIKPPLDLK
HPINEENQDGVMHSDGTGNLEEEQESDGEMYEDIESSKERDKKREKEEKKRLELERKEQK
EREKKEQELRKKFKLTGPIQVIHHAKACCDVKGGKNELSFKQGEDIEIIRITDNPEGKWL
GRTARGSYGYIKTTAVKIDYDSLKRKKNTINAVPPRPVEEDQDVYDDVAEQDAPNSHSQS
GSGGMFPPPPADDDIYDGIEEEDADDGSVPQVDEKTNAWSWGILKMLKGKDERKKSIREK
PKVSESDSNEGSSFPSPHKQLDVGEEVYDDVDASDFPPPPAEMSQGMSVGKTKAEEKDPK
KLKKQEKEEKDLRKKFKYDGEIRVLYSTKVASSLTSKKWGTRDLQIKPGESLEVIQSTDD
TKVLCRNEEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggcgaagttcaacaccgggagtaacccgacagaggaggtctccaccagcagcaggccc
ttcaaagttgcaggacaaaactccccttctggaatacaatcaaaaaagaatttatttgac
aaccaaggaaatgccagcccacccgcaggacccagcaacatgtctaaatttgggaccaca
aaaccacccttggcagcgaaacctacctatgaggagaagtctgagaaagagcctaaacct
ccgtttttaaaaccgactggagtgagcccaaggtttggaacacagccaaactcggtttct
agggatcctgaggtcaaagtggggtttctgaaacctgtaagccccaaacccaccagcttg
accaaagaagattccaaacctgtgattttacggcctcctgggaataagcttcacaatttg
aaccaagagtctgacttaaagacgctaggaccgaagccagggtctactcccccagtccca
gaaaatgatctgaagccagggttctcaaagatagctggagctaagagcaagttcatgcca
gcaccgcaagatgctgactccaaaccccgatttcccagacacacctacggccaaaagcca
tccctaagtacagaggacgcccaagaagaggaaagcatccctaagaatacgcctgtccag
aagggatccccagtgcagctcggagccaagtccaggggcagccctttcaaaccagctaag
gaagacccagaagataaagaccatggaacaccaagttcgccctttgctggagtggttctg
aaacctgctgcgagcagagggagcccggggctctccaaaaactctgaagagaaaaaagaa
gagagaaaaacagatattccaaagaacatctttctgaacaaactgaatcaggaagagccg
gccagattccctaaggccccttccaagctgacagcggggacaccatggggccaaagtcag
gagaaggaaggagacaaggattcagcaaccccgaagcagaagcccctgcctcccctgtcc
gtcttgggcccgcctccatccaagcccagcagaccacccaacgttgacctgaccagattc
cgaaaagctgactctgcaaacagttccaacaaaagccagacaccttactcgacaacctcc
ctgccaccacctccgcctacacagccagccagccagccaccgctgccggcgtctcaccca
gcacatctgccagcccccagcctgccccccagaaacattaagcctccccttgacctgaaa
catcctataaatgaagaaaatcaagatggtgtcatgcattctgatggtactggaaatcta
gaagaggaacaagagagtgatggagaaatgtatgaagacatagagtcatccaaggaacga
gacaagaaacgggaaaaagaagaaaagaagagattagagctagaacgaaaggagcagaag
gagagagagaagaaagagcaagaactgaggaagaaattcaagcttactggccccattcaa
gtcatccatcatgcaaaagcctgctgtgatgtcaaaggaggaaagaacgaactgagcttc
aagcaaggagaggacattgaaataatccgcatcacagacaatccagaagggaaatggctg
ggcagaactgcaaggggatcatatggttatattaaaacgactgccgtcaagattgactat
gattccctgaaacggaagaagaataccatcaatgctgttccaccgagacctgttgaagag
gaccaagatgtctatgatgatgtggctgagcaggatgctcctaacagccacagtcagagt
ggaagtggagggatgttcccaccaccgccagcagacgacgacatctatgatgggatagaa
gaggaagatgctgatgacggatccgtgccgcaggttgatgagaagactaacgcgtggtcc
tgggggattttgaagatgttaaagggaaaagatgaaagaaagaaaagcattcgagagaaa
cctaaagtctctgagtcagacagtaatgaaggttcatctttcccttctcctcataaacaa
ctggatgtgggagaagaagtttacgatgatgtggatgcctcagacttcccccctccacct
gcagaaatgagtcaaggtatgagtgttggaaagacaaaagctgaagagaaagatcctaag
aagctaaaaaagcaggaaaaggaagaaaaagacctcaggaaaaaattcaagtacgacggt
gaaattcgagttctatattcaactaaagttgcatcctccttaacttctaaaaagtgggga
acgagagatctgcagataaaacctggggagtctcttgaagttatacaaagcacagacgac
accaaagttctctgcaggaatgaagagggcaaatatggttacgtccttcggagttacctg
gtggacaatgatggagaaatctacgacgacatcgctgatggttgcatctatgacaacgac
tag

DBGET integrated database retrieval system