KEGG   Rattus norvegicus (rat): 50664
Entry
50664             CDS       T01003                                 

Gene name
Gnao1, Gnao, RATBPGTPC
Definition
(RefSeq) G protein subunit alpha o1
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    50664 (Gnao1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    50664 (Gnao1)
   04921 Oxytocin signaling pathway
    50664 (Gnao1)
   04926 Relaxin signaling pathway
    50664 (Gnao1)
   04916 Melanogenesis
    50664 (Gnao1)
  09156 Nervous system
   04724 Glutamatergic synapse
    50664 (Gnao1)
   04727 GABAergic synapse
    50664 (Gnao1)
   04725 Cholinergic synapse
    50664 (Gnao1)
   04728 Dopaminergic synapse
    50664 (Gnao1)
   04726 Serotonergic synapse
    50664 (Gnao1)
   04730 Long-term depression
    50664 (Gnao1)
   04723 Retrograde endocannabinoid signaling
    50664 (Gnao1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50664 (Gnao1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    50664 (Gnao1)
   05034 Alcoholism
    50664 (Gnao1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    50664 (Gnao1)
   05163 Human cytomegalovirus infection
    50664 (Gnao1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    50664 (Gnao1)
   05142 Chagas disease
    50664 (Gnao1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    50664 (Gnao1)
   04031 GTP-binding proteins [BR:rno04031]
    50664 (Gnao1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50664 (Gnao1)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    50664 (Gnao1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA DUF685 TniB AAA_24 AAA_29
Other DBs
NCBI-GeneID: 50664
NCBI-ProteinID: NP_059023
RGD: 628732
Ensembl: ENSRNOG00000019482
UniProt: P59215
Position
19p12
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDA
AAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaatctcaaagaagatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctctggagaagacgtaaagcagtacaagcctgtcgtctacagcaacaccatccagtct
ctggcagccattgtgcgggccatggatactctgggcgtggagtatggtgacaaggagagg
aaggcagactccaagatggtgtgtgacgtggtgagtcgcatggaggacactgaaccattc
tctgcagaactgctttctgccatgatgcgactctggggcgactcggggatccaggagtgc
ttcaaccgatctcgggagtatcagctcaacgactctgccaaatactacctggacagcttg
gatcggattggagccgctgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaacaactggcatcgtagaaacccacttcaccttcaagaacctccacttcaggctgttt
gacgttgggggccagcgatctgaacgtaagaagtggatccactgcttcgaggatgtcacg
gccatcatcttctgtgtcgcactcagcggctatgaccaggtgctccacgaggacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagtttttc
atcgatacctccatcattctcttcctcaacaagaaagacctctttggcgagaagattaag
aagtcacccttgaccatctgctttcctgaatacccaggctccaacacctatgaagacgca
gctgcctacatccaaacacagtttgaaagcaaaaaccgctcacccaacaaagaaatttac
tgtcacatgacttgtgccacagacacgaataatatccaggtggtattcgacgccgtcacc
gacatcatcattgccaacaatctccggggctgtggcttgtactga

DBGET integrated database retrieval system