KEGG   Rattus norvegicus (rat): 60357
Entry
60357             CDS       T01003                                 

Gene name
Prom1, CD133, Prom
Definition
(RefSeq) prominin 1
  KO
K06532  prominin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    60357 (Prom1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    60357 (Prom1)
   04090 CD molecules [BR:rno04090]
    60357 (Prom1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   60357 (Prom1)
CD molecules [BR:rno04090]
 Proteins
  60357 (Prom1)
SSDB
Motif
Pfam: Prominin Tweety DUF2207 ApoLp-III SUR7 DUF3573 DUF4382 HsbA Laminin_II IL11 Baculo_PEP_C DUF1664 DUF4190 Streptin-Immun DUF4404 Fez1
Other DBs
NCBI-GeneID: 60357
NCBI-ProteinID: NP_001103607
RGD: 69367
Ensembl: ENSRNOG00000003098
UniProt: A0A0G2K044 Q7TSL4
Position
14q21
AA seq 826 aa
MALVFSVLLLLGLCGKMASGGQPAFDNTPGALNYELPTTEYETQDTFNAGIIDPLYQMVH
IFLNVVQPNDFPQDLVKKLIQKRFDISVDTKEVAIYEIGVLICVILGLLFIFLMPLVGFF
FCMCRCCNKCGGEMHQRQKQNESCRRKCLAISLLLICLLMSLGIAFGFVANQQTRTRIQR
TQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKV
TPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCAS
DPASKICDSLRPQLSNLGSNHNGSQLPSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPN
MIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEE
YDSYWWLGGLIVCFLLTLIVTFFYLGLLCGVFGYDKRATPTRRGCVSNTGGIFLMAGVGF
SFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQVLDTPYLLNDQWQFYLSGILLKN
PDINMTFEQVYRDCKRGRGVYATFQLENVFNITENFNIERLSEDIVKELEKLNVNIDSIE
LLDKTGRKSLEDFAQSGIDRINYSMYLQEAEKPPTKVDLLTFASFLETEANQLPDGNLKQ
AFLMDAQNIRAIHQQHVPPVQQSLNSLKQSVWALKQTSSKLPEEVKKVLASLDSAQHFLT
SNLSSIVIGETKKFGRTIIGYFEHYLQWVLYAITEKMTSCKPMITAMDSAVNGILCSYVA
DPLNLFWFGIGKATMLLLPAVIIAIKLAKYYRRMDSEDVYDDPSRY
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggctctcgtattcagtgtcctgctgctactggggctgtgtggaaagatggcttcagga
ggtcagcctgcattcgataacactcccggggctttgaattatgaattgcctaccacagaa
tatgagacccaagacaccttcaatgctgggattattgaccctctctaccaaatggtgcac
atcttcctcaacgtggtccagccgaatgacttccctcaagatttggtcaaaaaactcata
cagaagaggtttgacatctcggttgataccaaggaggtcgccatctatgaaattggagtt
cttatctgcgtcatcctgggcctgctgttcattttcctcatgcccctggtgggcttcttc
ttttgtatgtgccgttgctgtaacaaatgcggcggagaaatgcaccagcggcagaagcag
aacgagtcgtgccggaggaagtgcttagccatctccctcttgctgatttgtctgctcatg
agtcttggcatcgcgtttggctttgtggccaaccagcagacaaggactcggatccaaagg
acccagaagctggcagagagcaattacagagacttgcgggctctcctgactgaagcccca
aagcaaatcgactatattctggggcaatacaacacaaccaagaacaaggcattctcagac
ctggacagtatcgattccgtgctgggaggcagaataaagggccaactaaaacccaaagtt
actcctgttctcgaagagattaaggccatggcaacagccattagacagaccaaggatgcc
ctgcagaacatgagcagcagtctgaaaagtctacgtgacgcaagcacccagctcagtacc
aacctgacgtctgtgagaaacagcatcgagaattcactcaacagcaacgactgtgcttca
gacccagccagcaagatctgtgatagcctcagaccacagctgagcaatctggggagcaac
cacaacggaagtcagctcccatcagtggacagggaactcaacaccgttaatgatgtcgac
agaaccgatctggagagcctcgtcaaaagggggtatatgtcgattgatgaaatacccaat
atgatacaaaaccaaactggggatgtcatcaaagatgtcaaaaagaccttggattctgtt
agctccaaggttaagaacatgagccaaagtattcctgtcgaggaggtgctgcttcagttc
tcccactaccttaatgacagcaacaggtacatccacgagtcgctgcccagagtggaagaa
tatgactcatactggtggctgggtggcttaatagtctgcttcctgctgaccctcattgtg
actttcttttacctgggcttgctgtgtggtgtgtttggctatgacaagcgtgccacccca
accagaagaggctgcgtgtccaacactggaggcatcttcctcatggctggggttggattc
agcttccttttttgctggatattgatgatccttgtggttcttacttttgttgttggtgca
aatgtggaaaagttgctctgtgaaccttatgaaaacaagaaattactacaggttttggat
actccctacctgctcaacgatcaatggcaattctatctctctggcatactactcaaaaac
ccagacattaacatgacctttgagcaagtctacagggattgcaaaagaggtcgaggagtg
tatgccacttttcagcttgagaatgtcttcaacatcactgagaatttcaacattgagagg
ctttctgaagacatagtgaaggagttggaaaagctgaatgtgaacattgacagcatcgaa
ctgttggacaaaacaggaaggaagagcctcgaggactttgcacaatctgggatagataga
atcaattattccatgtacttacaggaggctgagaaaccccctaccaaagtggacctgctg
acatttgcctcttttctggaaacagaagcaaaccagttgcctgacggaaatctgaaacag
gccttcttaatggatgcacagaacattcgagccatccaccagcagcacgtccctcctgtg
cagcagtcactgaattcattaaaacaaagtgtctgggcccttaagcaaacaagcagcaag
ttgccggaggaagtgaagaaggtccttgcctctttggattctgctcagcatttcctcacc
agtaacctctcctccatcgttattggagaaacaaagaagtttgggagaacaataataggc
tactttgaacattatctgcaatgggtcttgtacgccatcacagagaagatgacatcctgc
aaacccatgattacagcaatggactctgctgttaatggcattctgtgtagctatgttgct
gaccctctgaatctgttctggttcggcatagggaaagccaccatgctcttacttccggct
gtaatcatcgctatcaagttggccaagtactatcgcaggatggattcagaggatgtatat
gatgacccgtctcgatactga

DBGET integrated database retrieval system