KEGG   Rattus norvegicus (rat): 64557
Entry
64557             CDS       T01003                                 

Gene name
Bard1
Definition
(RefSeq) BRCA1 associated RING domain 1
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    64557 (Bard1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    64557 (Bard1)
   04121 Ubiquitin system [BR:rno04121]
    64557 (Bard1)
   03036 Chromosome and associated proteins [BR:rno03036]
    64557 (Bard1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    64557 (Bard1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     64557 (Bard1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    64557 (Bard1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     64557 (Bard1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     64557 (Bard1)
SSDB
Motif
Pfam: zf-RING_6 Ank_4 Ank_2 Ank_5 Ank_3 Ank BRCT_2 BRCT zf-RING_5 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_4 zf-RING_UBOX zf-RING_2 Prok-RING_4
Other DBs
NCBI-GeneID: 64557
NCBI-ProteinID: NP_072144
RGD: 621072
Ensembl: ENSRNOG00000014960
UniProt: Q9QZH2
Position
9q33
AA seq 768 aa
MPRRPPRVCSGNKPPPVPAMEPATDGLWAHSRAALARLEKLLRCSRCANILREPVCLGGC
EHIFCSGCISDCVGSGCPVCHTPAWILDLKINRQLDSMIQLYSKLQNLLHDNKGSDSKDD
TSRASLFGDAERKKNSVKMWFSPRSKKIRCVVNKVSVQTQPQKAKDDKAQEASVFEFVSA
TPPVVVSTRAKTASRTSAKKHPKKSVAKINREGNFRPETRDSRFDSKEKLKEEKVVSFSQ
TLVMENSRVNGEIDLLASGSVVESVFSGSFAEVSLPLAEHIVSPDTVSKSEEAPEKKVCV
EDRCPVGSDGNPKGCHRPPTSTSKKCGSNVPSASGEIREPTLLAENVVLVDCSSLPSGRL
QVDVTLRRQSNASDDSLSLSPGTPPSLLNNSTHRQMMSKPSTVKLSSGIPARKRNHRGET
LLHIASIKGDISSVEYLLQNGNDPNVKDHAGWTPLHEACSHGHLKIVELLLQHNALVNTT
GYHNDSPLHDAAKNGHIDIVKVLLSHGASRNAVNIFGERPVDYTDAENIRSLLLLPEKTD
SFSTSQCSVQVNTGQRKSGPLVLIGSGLSSQQQKLLSKLETVLKAKKCAEFDNTVTHVIV
PDEEAQSTLKCMLGILNGCWVLKFDWVKACLDSQEREQEEKYEVPGGPQRSRLNREQLLP
KLFDGCYFFLGGNFKHHPKEDLLKLIAAAGGRILSRKPKPDSDVTQTINTVAYHAKPDSD
QRFCTQYIVYEDLFNCHPERVRQGKVWMAPSTWLISCVMAFELLPLDS
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgccacgccggccgccgagggtctgctccgggaacaagcctcctcccgtgcccgccatg
gaaccagctaccgacgggctttgggcccacagccgtgcggcgcttgcccgtctggagaag
ttgttgcgctgctcccgctgtgctaatattctgagggagcccgtgtgcctaggaggatgc
gagcacatcttctgtagtggttgtataagcgactgtgttggatcaggatgcccagtgtgt
cataccccagcctggatcctagacctcaagataaacagacagttggacagcatgatccag
ctttatagtaagcttcaaaatttgctacatgacaataaaggttcagattcaaaagacgac
acatctagggcaagtttatttggtgatgcagaaaggaagaagaattcagtaaaaatgtgg
tttagtcctcgaagtaagaaaattagatgtgttgtgaataaagtttcagtacaaacccag
cctcaaaaggcaaaggatgacaaagcccaggaagcctcagtgtttgaatttgtttccgca
actccccctgtagttgtttctacgagggctaaaacagcttcaagaacatctgcaaaaaag
catcccaagaaatctgtagctaagatcaaccgggagggaaatttcaggccagaaacaagg
gatagtagatttgattccaaagaaaagctgaaggaagagaaggttgtctcctttagccaa
acactagttatggagaattcacgggtaaatggcgaaatagacttattagcgagtggctct
gtggtagaatccgtcttctctggcagctttgctgaagtctctttaccattggctgagcat
atagtgtctccagatactgtgagcaagagtgaagaggctcctgagaagaaggtctgtgta
gaagatcgttgtccagtagggagtgatggaaatcccaaaggctgccacaggcctcccact
tctacttctaagaaatgcgggagcaacgttccaagcgccagcggagaaatccgtgagcca
acattgcttgcagaaaatgtagtgttggttgactgttcttcactgccttcaggccgactt
caggttgatgtcaccctcaggagacagagtaacgcatcagatgactctcttagcctttca
ccaggcacacccccatctctgctgaacaattccactcacagacaaatgatgtcaaagccc
tccacagtgaagctgtcttctggtattccagccaggaaaagaaatcacagaggagagacg
ttactgcacattgcctctataaagggtgatatatcttctgttgaatacctcttgcaaaat
ggaaacgacccaaatgttaaggaccatgctggatggacaccgttgcatgaagcctgcagt
catgggcacctgaagatagtggagctgctgctccagcacaatgccttggtgaacaccacc
ggctatcacaatgactcgccactgcacgatgccgccaagaatggccacatcgatatagtc
aaggtgttactgtcccacggagcttccaggaacgctgttaacatatttggtgagcggcca
gtggattacacagacgctgagaatataaggtcattattgctgctgccagagaagacggat
tcattctcaactagccagtgctctgtccaggtgaacaccgggcagcggaagagtgggccg
ctggtactaataggcagtgggctttcttcacagcagcagaaactgctcagcaaacttgag
acagtgctaaaggctaagaagtgtgctgagtttgacaacacagtaactcatgtcattgtt
cctgatgaggaagctcagagtaccttgaagtgtatgcttgggattctcaatggatgctgg
gtcctgaagtttgattgggtgaaagcctgtttggacagccaagaacgtgagcaggaagaa
aagtatgaagttcctggaggtccgcagaggagcaggctcaacagagagcagctgctgccc
aaactgttcgatggatgctacttctttctgggggggaacttcaaacatcatccaaaagaa
gacctcctgaagctcattgctgcagcaggaggcagaatcctcagcagaaagcccaagcca
gacagtgacgtgactcagaccatcaacacggttgcataccatgccaagcctgactctgat
cagcgcttctgtacgcagtacattgtctatgaggatctgtttaactgtcacccagagagg
gttcggcagggcaaagtctggatggctccttccacctggctaatcagctgtgtaatggcc
tttgagttgcttcctcttgacagctga

DBGET integrated database retrieval system